(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1068

AL596167.LIN1068     Location/Qualifiers
FT   CDS_pept        126847..129171
FT                   /transl_table=11
FT                   /gene="lin1068"
FT                   /note="similar to hypothetical protein 3 (capsulation
FT                   locus) of Haemophilus influenzae"
FT                   /db_xref="GOA:Q92CV3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV3"
FT                   /protein_id="CAC96299.1"
FT                   /translation="MSKDSNKIIEQSREIGISIIMPLYNVEEVILETLESIHEQTFDSY
FT                   EVLLIDDGSTDKTIEIVTEYIKDKPRFKLYTQPNGGPASARNHGLRLAIGMYICFVDSD
FT                   DILPNYSLQLMYDGAISTGAKLITGATKRFNSEGEWFIPMHIQYNIAKPGMKTLLKNPE
FT                   LFYSIGPCAKLYHHSLIDGVFFPENIRYGEDQPFVLHALLQAKDIYTVEKVVYYYRLRD
FT                   GESQSLTQSVDKDPIRILKSVFQIFDYGEEELKKNNTDYEVALKYYQRVSSVELWGALR
FT                   AAIESKKSENQKIAFTMTLDWLKTKSDDFLNIIPSFRYFLLFSSIERVRYITKDNKENY
FT                   RNLIGYLWSRQGEEAKIAFRKTYPIPMKAALQIIENNNWRDARKISFKFIVRRKFKAPI
FT                   LIRKISRGIIFRIATLMPRKKNQVILATERSTTLEGNLLAIYDYMFYNNMPQKVYVFLR
FT                   KNRNWFEMFQLYYTLGRTKTIVLDDYYNKIYGLKFNKNTHVVQSWHATGAFKKFGFSAL
FT                   EGTDANTEEFETRAHSPYTDVLVSSEGIIPEYMEAFRKQANQIKPIGVPRTDVFFDDEY
FT                   VNYTKEKYMKMYPQLRDKKILLYAPTFRGGPNERFNYSVVLDIAALKKELGDTHILILK
FT                   FHPVIKNVSFNVEEDDPFILNLTLNNDINDLMLFSDALITDYSSVIFEFSLMNKPIYFF
FT                   AYDIDDYLDERGFYFDYKATIPGEVFRDTPSLIEAVKSGLYNYDELEIFKKKFVGSLDG
FT                   NSTKRFVETYIGKANEKVKDI"
     atgagtaaag attcaaataa aataattgaa caaagccgag aaataggaat aagcataatt        60
     atgccacttt ataatgtgga agaagtaata cttgaaactc tcgaaagtat tcatgagcaa       120
     acttttgata gttatgaagt gttattaatt gacgatggtt caacagataa aacaatagaa       180
     attgtaaccg aatatataaa agataagcca cggtttaaat tatacactca accaaacgga       240
     ggaccagctt ctgcaaggaa ccatggttta cgacttgcaa taggtatgta tatttgtttt       300
     gttgatagtg atgatatact gcctaactat tccttacaac taatgtatga tggtgctatt       360
     tctacagggg caaaactaat tactggagca accaaacgtt ttaattcaga gggcgaatgg       420
     tttataccaa tgcatattca atataatatt gctaaaccag gaatgaaaac cttattaaaa       480
     aatcctgagt tgttttattc aattggacca tgtgcgaaat tgtatcacca ttcactaatt       540
     gatggcgtat ttttcccaga gaatattcgc tacggggaag atcaaccgtt tgttttacat       600
     gctttattgc aagccaaaga tatttataca gtagaaaaag ttgtttatta ttatcgttta       660
     cgcgatggtg aatcgcaatc attaacgcaa tcagtagata aagatccaat tcgtatttta       720
     aagtctgttt tccagatttt tgactatggt gaagaagaac tgaaaaaaaa caacactgat       780
     tacgaggttg ctttaaaata ttatcaacgc gtttctagtg tggagctttg gggagcgtta       840
     cgagcagcaa tagaaagcaa aaaaagtgag aaccaaaaaa ttgcttttac aatgacttta       900
     gactggttga aaacaaaatc agatgacttt ttaaatatta tcccttcatt tagatacttc       960
     ttgttattta gtagtattga gcgtgtacgt tatataacga aagacaataa agaaaactat      1020
     cgtaatttaa ttggttattt atggagccga caaggggaag aagctaaaat tgcatttaga      1080
     aaaacttacc caattcccat gaaggctgct ctacaaataa ttgaaaataa taattggcgt      1140
     gatgctcgta aaatttcatt taaatttatt gttcgacgca agtttaaagc tccaatttta      1200
     attcgtaaaa taagtagagg gattattttt agaattgcta cattaatgcc acggaagaag      1260
     aaccaagtga tattagctac agaacgtagc accactttgg aaggtaattt attagcaatt      1320
     tatgattata tgttttataa caatatgcct caaaaagtat atgtgttttt acgaaaaaat      1380
     cggaattggt ttgaaatgtt tcagctatat tatacgctgg ggcgaacgaa aacaattgtt      1440
     ttagatgatt attacaataa aatttacggt ttgaaattta acaaaaatac acatgttgtg      1500
     cagtcatggc atgcaacagg cgcatttaag aaatttggat ttagtgcgct ggaaggtaca      1560
     gatgcaaata cagaagaatt tgaaactcgt gcgcattccc cttatactga tgtgcttgta      1620
     agctcagaag gaattattcc ggaatatatg gaagctttta gaaaacaagc taatcaaatt      1680
     aaaccaattg gtgtacctcg aactgatgtg ttttttgatg atgaatatgt gaattataca      1740
     aaagaaaaat atatgaaaat gtatccgcaa ttgcgcgata aaaaaatatt gttatatgca      1800
     cctactttcc gtggtggacc gaatgagcgt tttaattata gtgtagttct tgatattgca      1860
     gcgttgaaaa aagaacttgg cgatactcat atcttaattt tgaaattcca tccggttatt      1920
     aaaaacgttt cattcaatgt agaagaagat gatccgttta ttttgaattt aacgctaaat      1980
     aatgatatta atgacttaat gttattcagt gatgcgctta ttactgatta ttcttctgtc      2040
     attttcgaat ttagtttgat gaacaaaccg atttatttct ttgcctacga tattgatgat      2100
     tatcttgatg aacgtggttt ctactttgat tataaagcga ccattcctgg tgaagtgttt      2160
     agagatacac catcgcttat tgaagcggtt aaaagtggtc tatataatta cgacgagttg      2220
     gaaatcttta aaaagaaatt tgttggtagt ttggatggga attcaacgaa acgttttgtt      2280
     gagacttata ttggaaaagc aaatgagaaa gtgaaggata tatga                      2325
//

If you have problems or comments...

PBIL Back to PBIL home page