(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1073

AL596167.LIN1073     Location/Qualifiers
FT   CDS_pept        133214..134602
FT                   /transl_table=11
FT                   /gene="lin1073"
FT                   /note="similar to galactosamine-containing minor teichoic
FT                   acid biosynthesis protein GgaA "
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU8"
FT                   /protein_id="CAC96304.1"
FT                   /translation="MKFAIIIPFYNAEKRLALSIDSIIKQTYSFLKHVEVLLINDGSTD
FT                   RSSAIAHSYAEKYPSNIRVFDVPNGGPSKARNIGIHNVQEDTDFVGFLDADDLLSPNML
FT                   FSMVNFLEKSAVNMLVPAFYYLDDFGKKQKISPHKLNDRFTNGNRVVAIEKEPQAIHFY
FT                   IGGTFFRFESLKQFVFDETLNFAEDQLLITKFLLENRSYGLIADAGYYYYRDLKQKGSL
FT                   VSSAWKQPERYTPFLQKVYQTYLTNSKEIFGEVIPYVQYLIAYHAKLFFYKENIYFKEV
FT                   LNEQEQEIFVRELQKILQEVGPEMIVALDTPLVVKEMMLSILRNGWPVQFKTAELEEVP
FT                   LVTVKENYRPGKAVTVELLLEEARETLSDGGEFFASTSVGTAQTKVVKRKTAQTIWDIV
FT                   VREEGTLEKVVTRLKPYQLKVQVFYQDKNQKITMTDLNVIKSVLGKLKRNKALKRKFKQ
FT                   GGVS"
     atgaaatttg cgattataat tcctttttac aatgcggaaa aaaggttggc tttatcgata        60
     gatagtataa ttaagcagac ttacagcttt ttgaagcatg tggaagttct gcttattaat       120
     gatgggagca cggaccgtag tagtgcgatt gctcatagct atgccgaaaa atatccgagt       180
     aatattcgcg tttttgatgt cccgaatggt ggtccttcta aggcgagaaa tattggaata       240
     cataatgtac aagaagacac tgactttgta ggatttttag atgcagatga tctgttatcg       300
     ccaaatatgc tttttagtat ggtgaacttc ctagaaaaat cagctgttaa tatgcttgtc       360
     ccagcttttt attatttaga tgattttgga aaaaaacaaa aaatttctcc acataaatta       420
     aatgaccgtt tcacaaatgg aaatcgagtt gtagcgattg aaaaagaacc gcaagcaatt       480
     catttttata ttggcggtac tttttttcgt ttcgaaagtt tgaagcaatt tgtctttgat       540
     gaaacgctta actttgcgga agatcagctt ttaattacga aatttttgct tgaaaataga       600
     agttacggat tgattgccga tgctggttac tattactatc gtgatttaaa gcaaaaaggt       660
     tctttagtaa gttcagcttg gaagcaaccg gaaagatata cgccattttt acaaaaggtg       720
     taccaaactt atttaacaaa ctctaaagaa atttttggcg aagtgattcc atatgtgcag       780
     tatttaatcg cgtaccatgc caagttgttt ttttataaag aaaacattta ttttaaagaa       840
     gtattaaatg agcaggaaca agaaatcttt gtgcgtgaat tacagaaaat attacaagaa       900
     gttggtccgg agatgattgt agctctggat acaccgcttg ttgtaaaaga aatgatgctc       960
     tctattttgc gaaacggctg gccagtacag tttaagacgg cagaattaga agaagttccg      1020
     cttgtcacag taaaagaaaa ttaccgtcct ggaaaagctg taacagtgga actcttacta      1080
     gaagaggcgc gggaaacttt atcagatggc ggagaattct ttgctagtac atctgtaggt      1140
     acggcgcaaa caaaagtggt aaaacgaaaa acagcccaaa caatttggga tattgttgtt      1200
     cgtgaagagg gtacacttga aaaagtggtg acacggttaa aaccatatca attgaaagtc      1260
     caagtgtttt accaagacaa aaatcaaaaa ataacaatga cagatttaaa tgtcatcaag      1320
     agtgtgttag gaaaattaaa aagaaataaa gctttaaagc gaaagtttaa acagggggga      1380
     gtatcctga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page