(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1074

AL596167.LIN1074     Location/Qualifiers
FT   CDS_pept        134602..135756
FT                   /transl_table=11
FT                   /gene="lin1074"
FT                   /note="similar to B. subtilis TagF protein (probable
FT                   CDPglycerol glycerophosphotransferase)"
FT                   /db_xref="GOA:Q92CU7"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU7"
FT                   /protein_id="CAC96305.1"
FT                   /translation="MKFVQKIYYFLFKLVGFLPRRKELVMFESFSGKQYSCNPRAIFEY
FT                   MEEHNPEYELLWSVNPKYVDLFEAHGVPYVKRFSVNWLFKMGLAKFWISNSRLPLELPK
FT                   PKKTIYVQTWHGTPLKKLGVDIDEVHMPGQTTEQYKADFVKEAQKWDYLISPNAYSSTI
FT                   FRRAFGFTGEMIESGYPRNDILFSADKELKIANIKMALNIPEDKKVILYAPTWRDNDFY
FT                   EIGKYKFDLKIDIAKMQEKFGDEVVLLVRMHYLVAEHFDFTQYGDFVRDASKHEDIRDL
FT                   YLVSDLLITDYSSVFFDYANLKRPMLFYTYDLAEYRDTLRGFYFDFEQNAPGPLVEMND
FT                   ALMAEIEIMLENPPQIAESFLEQFCTWEDGHAAEKTVKKVFAEK"
     atgaagtttg tacaaaaaat atattatttc ctatttaagc tagtaggatt tttacctcga        60
     agaaaagaat tagtgatgtt tgaaagcttt tctgggaagc aatatagttg taatccacgt       120
     gctatttttg aatatatgga agagcataat ccagaatacg agttgttgtg gagtgtaaat       180
     ccgaagtatg ttgatttgtt tgaagcgcac ggggtaccgt atgttaagcg tttttctgtt       240
     aattggttgt ttaaaatggg cttagctaaa ttttggattt ctaatagtag actgccgctt       300
     gagctaccaa aaccgaaaaa aactatttat gtacaaacgt ggcacggaac gcctttgaaa       360
     aaactaggtg tcgacatcga tgaagtacat atgcctggcc aaacaaccga acaatacaag       420
     gctgattttg tgaaagaggc gcagaagtgg gattatttaa tttcacctaa tgcgtattct       480
     agtacgattt tcagacgtgc atttggtttc actggggaaa tgattgagtc tggctatccg       540
     agaaatgata ttttatttag tgcggataaa gagttgaaaa tcgctaatat caaaatggcc       600
     ttaaatattc cagaagataa gaaagttatt ttatatgcgc caacttggcg tgataatgat       660
     ttttacgaaa tcggaaaata taagtttgat ttaaagattg atattgccaa aatgcaagaa       720
     aaatttggcg atgaagtcgt tctgttagtt cggatgcatt atctcgtagc agaacatttt       780
     gatttcacgc agtatggcga ttttgtacga gatgcttcaa aacacgaaga tattagagat       840
     ttgtatttag tgagcgattt attaattacc gattattctt ccgtattttt tgattatgct       900
     aatttaaaaa gaccaatgtt gttctatacg tatgatttgg ctgaatatcg cgatacactt       960
     agaggctttt actttgattt tgaacaaaat gccccaggac cacttgttga aatgaatgat      1020
     gctttaatgg cagaaataga aatcatgctt gaaaatcctc ctcaaattgc agaaagcttt      1080
     ttagaacaat tctgtacttg ggaagacggg cacgcagcag agaaaacagt gaaaaaagtt      1140
     tttgctgaaa aatag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page