(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1075

AL596167.LIN1075     Location/Qualifiers
FT   CDS_pept        135769..136920
FT                   /transl_table=11
FT                   /gene="lin1075"
FT                   /note="similar to teichoic acid biosynthesis protein B
FT                   precursor"
FT                   /db_xref="GOA:Q92CU6"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU6"
FT                   /protein_id="CAC96306.1"
FT                   /translation="MKKIAIYMYMLAVKIIGFLASLLPVQQKVVFLISFEENPTAIIKQ
FT                   MKLSNVTPKTIVFYDPRVDVSKLSLDFIKVKPKTLQQFIPLMFHLNTAKVVVTDNYFVE
FT                   LAGLKLRNGVNCIQVWHANGALKKFGWEDKAAQKRSDRDKKRFQEVYKRFTKVLVGSDE
FT                   MASIFKKSFLLDESNMLKLGVPRTDYFFKEAQLQENYQWSYEHLHLTNRIKLLYAPTFR
FT                   DNELGMAKLHLDIAEMKQALGNEYQLILKLHPSISNDLEKLDDDFVIYVDKETPIETLL
FT                   PVVDILITDYSSIPFEFALLQKPMIFFTYDLTEYNNARGLSDGFLETIPGPHVFTTTEL
FT                   IEVIQNNTFDLEKVRLFAEKWNKYSDGFSSERFVSFLKEQLEK"
     ttgaaaaaaa tagcaattta tatgtatatg cttgctgtta aaataattgg attcttggcg        60
     agccttttac cagttcagca aaaagttgtt tttcttataa gttttgaaga aaatcccact       120
     gcgattatta agcaaatgaa actgtccaat gtcaccccga aaacaattgt cttctatgat       180
     cctagagtag acgtatcaaa gttatcttta gactttataa aagtaaaacc gaagacactg       240
     caacaattta ttccattaat gtttcacctc aatacggcaa aagtagttgt cacagataat       300
     tattttgtgg aattagctgg cttgaaatta cgaaatggcg taaattgtat ccaagtttgg       360
     cacgcaaacg gtgcgcttaa gaaatttggc tgggaagata aagcagcgca aaaaaggtca       420
     gatcgggata agaaaagatt tcaagaagta tataaacgtt ttacaaaagt acttgttggt       480
     tctgatgaaa tggcatcaat tttcaaaaaa tcatttttac tagatgaatc gaacatgttg       540
     aaacttggtg ttccacggac tgattatttc ttcaaagaag cgcagttaca agaaaattat       600
     cagtggtcat acgagcattt acatttaaca aacagaataa aattactata tgcgccgact       660
     tttcgggata atgagttggg aatggcaaag ttacatttag atattgcgga aatgaaacaa       720
     gccttaggaa atgaatatca attgatttta aaattacatc cttctattag taatgattta       780
     gagaaactag atgatgattt tgtcatttat gtggataaag aaacgccgat tgaaacgtta       840
     ctaccagttg tggatatttt gattactgat tattcttcca ttccgtttga gtttgcttta       900
     cttcaaaaac caatgatttt ctttacgtat gatttaacgg aatataataa tgctagagga       960
     ctttcagatg gctttttaga aaccattccc ggtccgcatg tttttacaac gactgagcta      1020
     attgaagtaa tacaaaataa tacgtttgat ttggaaaaag ttcggttatt tgctgagaaa      1080
     tggaataaat attcggatgg attttcaagt gagcgttttg tatccttttt aaaagaacag      1140
     cttgaaaagt ag                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page