(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1077

AL596167.LIN1077     Location/Qualifiers
FT   CDS_pept        137486..138976
FT                   /transl_table=11
FT                   /gene="lin1077"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YueK protein"
FT                   /db_xref="GOA:Q92CU4"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU4"
FT                   /protein_id="CAC96308.1"
FT                   /translation="MTNLFQDDSLTLHTDLYQLNMMKAYFDDGLHERRSVFEVFFRDMP
FT                   FDSGFVVFAGLERIINYMQNLRFTETDIAYLHDELGFDGPFLEYLRNFKFKGNILAAKE
FT                   GEFVFKTEPILQVEASLAEAQLIETALLNIVNFQTLIATKAARIRSVIDDETFAEFGTR
FT                   RAQEMDAAIWGTRAAYIGGCDSTSNVRAGKIFGIPVSGTMAHAMVQAYRDELEAFRSYA
FT                   KTHFDSIFLVDTYDTLKSGVPNAIKVAKEMGDKINFIGIRLDSGDMAFLSKKARQMLDE
FT                   AGFTEAKIFASSDLDEHTILSLKAQKAKIDSWGVGTKLITAYDQPALGAVYKMAAIADE
FT                   NDILQDSIKLSSNTEKVSTPGKKKVYRIITNEDGLKAEGDYIALADESLENVDKLTMFH
FT                   PVHTYIMKTVENFTARELLVPIFKDGELVYDMPTLDEIKAYKEENLALLWDEYKRTVRP
FT                   EQYPVDLSVKCWKNKMRNIEKVRKSVQLHSPVELDMPF"
     atgacaaatt tatttcaaga tgatagtcta acgctgcata cagacttata tcaactaaat        60
     atgatgaaag cgtattttga cgatggactt catgagcgta gatcggtatt tgaagtgttt       120
     ttccgagaca tgccatttga ttcaggtttt gttgtatttg ctggactgga acgaattatt       180
     aattatatgc aaaatttacg ttttacagaa acggatattg cttatttaca tgatgaactt       240
     gggtttgacg gacctttcct cgaatatcta cgtaatttta aatttaaagg aaatattctt       300
     gctgcaaaag aaggggaatt cgtgtttaaa accgagccaa tccttcaagt agaagcaagc       360
     ttggcagaag cacaattaat cgaaacagct ttgcttaata ttgtgaattt ccaaacgcta       420
     atcgctacaa aagctgcgcg aattcgttct gttattgacg acgaaacgtt tgctgaattc       480
     ggaacaagac gcgcgcaaga aatggatgca gctatttggg gcacacgagc ggcttacatc       540
     ggcggttgtg attccacaag taatgttcga gctggaaaga ttttcggtat tcctgtgtct       600
     ggtacgatgg cacatgcgat ggttcaagcc taccgcgacg aactagaagc atttagaagt       660
     tacgcaaaaa cgcattttga ttcgattttc ttagtagata catacgatac gctaaaatcc       720
     ggcgtaccaa atgcgattaa agtagcgaaa gaaatgggcg ataaaatcaa ctttatcggc       780
     atccgcctag atagtggcga tatggctttc ctatctaaaa aagcgcgcca aatgttggat       840
     gaggctggtt ttacagaagc gaaaattttt gcttcaagtg acttagacga acatactatt       900
     ttatccttaa aagcgcaaaa agcgaaaatt gattcttggg gtgtgggtac gaaacttatc       960
     acggcctacg atcaaccagc gctgggagca gtttacaaaa tggcggcgat tgctgatgaa      1020
     aatgatattt tacaagattc gattaaactt tctagtaaca ccgaaaaagt ttcaacacct      1080
     ggtaagaaga aagtttaccg gattattacg aatgaagatg gtttaaaagc agaaggtgat      1140
     tatattgctt tagcggatga atcacttgaa aatgtcgaca aactaacgat gttccaccca      1200
     gttcatacgt atattatgaa gaccgtcgag aatttcactg ctcgcgagtt acttgtaccg      1260
     atttttaaag atggggaact tgtttatgac atgccgactt tagatgaaat taaagcatat      1320
     aaagaagaaa acttggcgct gctttgggat gagtataaac gaactgttcg tccagagcaa      1380
     tacccagttg atttaagtgt aaaatgttgg aaaaacaaga tgcgtaatat cgaaaaggta      1440
     cgtaaaagtg tccaacttca ttcaccagtt gaactagata tgccgtttta g               1491
//

If you have problems or comments...

PBIL Back to PBIL home page