(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1078

AL596167.LIN1078     Location/Qualifiers
FT   CDS_pept        138988..139812
FT                   /transl_table=11
FT                   /gene="lin1078"
FT                   /note="similar to NH(3)-dependent NAD(+) synthetases,
FT                   nitrogen regulatory protein"
FT                   /db_xref="GOA:Q92CU3"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CU3"
FT                   /protein_id="CAC96309.1"
FT                   /translation="MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVL
FT                   GISGGQDSTLTGKLAQMAISELRAETGDDEYQFFAVSLPYGTQLDESDRQDALDFMAPD
FT                   NRLTVNIKASVDASVAALAEAGVELSDFAKGNEKARERMKVQYAIAAMHKGVVVGTDHS
FT                   AEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALP
FT                   DEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK"
     atggaaatca gagaaagaat tttagcagat atgcaagtgg cagaaacaat tgatgcacac        60
     gaagaaatcc ggaaaagtgt cgagttttta aaagcatatt taaaaaagaa tacgttctta       120
     aaaagctttg ttctggggat ttctggggga caagattcga ctttaactgg aaaactagca       180
     cagatggcga taagcgaatt acgagcggaa acaggtgatg atgagtacca attcttcgct       240
     gtgagcttgc catacggaac acaactagat gaatcggacc gtcaagatgc acttgatttt       300
     atggcaccag ataatcgctt aaccgtgaat attaaagctt cggttgatgc gagtgttgcg       360
     gcgcttgcgg aagcgggagt tgaactatct gatttcgcta aaggtaatga aaaagcgcgc       420
     gaacggatga aagttcaata cgcgattgca gcgatgcaca aaggcgtcgt tgttggaacc       480
     gatcactccg cggaagcagt tactggcttt tatacgaaat acggcgacgg gggaacggat       540
     attaatccac tgttccgctt gaataaaaga caaggcaagg cgcttcttaa agagcttggc       600
     tgcccagaac atttatattt gaaaaaaccg actgcggatt tagaagataa taagccagca       660
     cttcctgatg aagtcgcgct tggtgtaact tatgaccaaa ttgacgatta cttagaaggc       720
     aaagaagttc cagcagatgc tgcggcaaaa attgagaatt ggtttattaa aaccgaacat       780
     aaacgccata tggcaattac tatatttgac gatttctgga aatag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page