(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1092

AL596167.LIN1092     Location/Qualifiers
FT   CDS_pept        149550..150002
FT                   /transl_table=11
FT                   /gene="lin1092"
FT                   /note="similar to E. coli YjaB protein"
FT                   /db_xref="GOA:Q92CS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS9"
FT                   /protein_id="CAC96323.1"
FT                   /translation="MILINKRAEKQDYQTILAIWEKSVIVTHDFLTAEDRQFYKEQIPL
FT                   FLDNVELFLWFAGEEVIGFSGTSERELDMLFLDPVATGNGYGSQILGWLIENKRINLVD
FT                   VNEQNENATRFYLKHGFVVSSRSDLDGFGKPYPILQLQLKERVNGV"
     atgatactta taaataaacg agcggaaaaa caagattacc agacaatttt agcgatttgg        60
     gaaaagtcag ttattgtaac gcatgatttt ttaactgcgg aagataggca gttttacaaa       120
     gaacaaattc ctttgtttct agataatgtg gaactgttct tatggttcgc tggtgaggag       180
     gtcattggtt ttagtgggac gagcgagcgg gaactagata tgttgtttct ggatccggta       240
     gccacgggta atggttatgg gagtcagatt ctgggttggc taatagaaaa taagcggata       300
     aacctggtgg atgtgaatga acaaaatgaa aatgccacga gattttattt gaagcatgga       360
     tttgtggttt cttccagaag tgacttggac ggttttggga agccttatcc aattcttcaa       420
     ttgcaactga aggagagagt taatggagta tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page