(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1101

AL596167.LIN1101     Location/Qualifiers
FT   CDS_pept        158071..159624
FT                   /transl_table=11
FT                   /gene="lin1101"
FT                   /note="similar to internalin, putative peptidoglycan bound
FT                   protein (LPXTG motif)"
FT                   /db_xref="GOA:Q92CS0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS0"
FT                   /protein_id="CAC96332.1"
FT                   /translation="MKKTIKITTSLLLSFACVFSVGDFTKPHTVEAETVYSLTNPKPIN
FT                   EIFSDPKLAQVVADWLKLPSATSAVTQSQLNTVKSLHFDSKGVQSLEGVEYLKNLTQVF
FT                   GYGNQVSDLGPLSNLTQLEIIQMPRNQISDLTPISNLTALMSLDFEFNNLQTIEPIKNL
FT                   TNMLELNVSANPISDISAVKNMTQLEFLTIRDCEVSDLSPVENLSNMLMFWAGRNNISD
FT                   ITPLKNMPKLLGLSLFGNQIKDVSVVKNLTSLEDFDLKANQVSDISSLATSTTLETLTL
FT                   SFNQIIDISPLKNLTNLTRLELENQTRVLDAVEVDNPLILPAPVIDENGSRVQPTKVSH
FT                   AGIYANGEITWEGLQSNYILNYEYNLPVAIGSLTTTYSGKITQPLLEKPVDPITPVDPV
FT                   DPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPIDPVNPVDPITPVDPSNQVNSTDP
FT                   VKSVLQATETLIKQTISVNPIVAKDNRNLPKTGDSGMTSSLVGGLILAVSSLVLLRKRK
FT                   "
     atgaaaaaaa cgatcaagat tacaaccagt ttacttttga gctttgcttg tgtatttagt        60
     gttggggatt ttactaagcc gcatacagtc gaagctgaaa cagtctattc acttacaaat       120
     ccaaagccga ttaatgaaat tttttctgat ccaaagctcg cgcaagttgt ggcggattgg       180
     ttaaagcttc catcagcgac tagcgcggtt acgcaaagcc aattgaatac agttaaatct       240
     ttgcactttg attcaaaagg tgttcaaagt cttgaaggag tagagtattt aaaaaatctc       300
     acgcaagtat ttggctatgg taaccaagtg agtgatctag gaccattaag taatttaacg       360
     caactcgaaa tcatccagat gccaagaaac caaataagtg atttaacacc catttcgaat       420
     ttgacagcat taatgtcact tgattttgaa tttaataatt tacaaacgat tgaaccgata       480
     aaaaatttaa cgaacatgtt agaactgaat gttagcgcaa atcctatttc ggatattagt       540
     gccgttaaaa acatgacgca actggaattt ttgactataa gagactgtga ggtaagtgat       600
     ttatcgccag ttgaaaatct gtctaatatg ctgatgtttt gggcagggag aaataatatt       660
     agtgatatta cgccgctcaa aaatatgccc aaactgcttg gtttaagttt atttgggaat       720
     caaatcaagg atgtgagtgt ggttaaaaat cttactagcc ttgaagattt cgatttaaaa       780
     gcgaatcagg tgagcgatat tagtagctta gcaacgtcaa ctacactcga gacattaact       840
     cttagtttca accaaataat tgatatttcg cccctgaaaa atttgaccaa tttaactagg       900
     ttagaacttg agaaccaaac gcgtgtatta gatgcggttg aggtagataa tccattgatt       960
     ttacccgctc cagtaattga tgaaaatggc agcagagtac agccgacaaa agtaagtcat      1020
     gcgggtattt atgcaaatgg cgagattaca tgggaagggt tgcaaagtaa ttatattcta      1080
     aattacgagt ataatttacc cgtagcaatt ggttcgttaa caacaacgta ttctggtaaa      1140
     attacccagc cactgttgga gaagcctgtt gatccgatta ctccggtaga cccagtagac      1200
     ccggtagatc cagtagaccc ggtagacccg gtagacccgg tagacccggt agacccggta      1260
     gacccggtag acccggtaga cccggtagac ccggtagacc caatagatcc agtaaacccg      1320
     gtagatccaa tcactccagt agacccgtca aatcaagtaa attcaactga tccagtgaag      1380
     tcagttcttc aagcaactga aactttaata aaacagacga tatccgttaa tccgattgta      1440
     gctaaagata atagaaattt accgaaaaca ggggatagtg gaatgacttc tagtttagtt      1500
     ggcggtttaa ttctagctgt ttctagtttg gtattattgc gtaaacgaaa ataa            1554
//

If you have problems or comments...

PBIL Back to PBIL home page