(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1106

AL596167.LIN1106     Location/Qualifiers
FT   CDS_pept        161867..163231
FT                   /transl_table=11
FT                   /gene="lin1106"
FT                   /note="similar to Salmonella enterica PduS protein"
FT                   /db_xref="GOA:Q92CR5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017054"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR5"
FT                   /protein_id="CAC96337.1"
FT                   /translation="MSQMSILEKIKDAGVVGCGGAGFPTHAKFSGEVEYLIINAAECEP
FT                   LLKTDHFVMRNHAVETIKAIEMVKNQVGAEFAVIATKRYYTEEIAALRSAITELNASVT
FT                   IHEMDNVYPTGDEQVMVFEVTGRVVPPSGIPLMVGCIVSNVSTMWNVFHAIQDDAPVIR
FT                   KQLTVTGAVGEPKLLDVPVGTPFEVCLAAAGGTNLDEYLFLDGGPMMGKLNDQSTIAEK
FT                   VVTKTTSGLIVAEDTGYLHKLHYQTVEQIFNETKSACIQCSLCSDLCPRQQLGHDIHPH
FT                   KVMRHFAVAEDITDIKPDPIWEEAMICCECGICEVIACPMGLSPRQVNIHVKKELLKQG
FT                   VRYQTDKKEFTPDPMRDYKSIAPKNILIKMGLQQYADVHLETMHYLDVDEVFIPTKMHI
FT                   GAPSIPVVSEGDIVKKGDLIAKIPDTALGANIHASIDGQIIRITEEQVHIKRVMS"
     ctgagccaaa tgtccatttt agaaaagatt aaagatgccg gagttgttgg ttgtggtgga        60
     gcgggctttc cgacccatgc caaatttagc ggtgaagtgg aatacttaat tattaacgca       120
     gcggaatgtg aaccgctcct aaaaacagat cattttgtca tgagaaacca tgcagtagaa       180
     acgattaaag caattgaaat ggttaaaaac caagtaggtg cagagtttgc cgttattgca       240
     acaaaacggt attacacaga agaaattgcg gctttacggt cagcaattac agaactaaat       300
     gcaagcgtga caatacatga gatggataat gtctatccaa ctggcgacga gcaagtgatg       360
     gtctttgaag tgactggacg cgttgtgcca ccaagcggta ttccacttat ggttggctgt       420
     attgtatcga atgtctcgac aatgtggaac gtctttcatg caattcaaga tgacgcgcca       480
     gttattcgta aacagttgac agtaactgga gcagttggag agccaaaact tttagatgta       540
     ccagttggaa cgccatttga agtatgttta gcagcagctg gtggaactaa tttagacgag       600
     tatttatttt tagatggtgg accgatgatg gggaaattaa atgatcagtc cactattgct       660
     gaaaaagttg taacgaaaac aacttcgggt ttgattgtgg cagaggatac gggttatctg       720
     cacaagctac attaccaaac agtggaacaa atttttaatg aaacaaagtc ggcttgtatt       780
     cagtgttcgc tttgttcgga tttatgcccg agacaacaat taggtcatga tattcatccg       840
     cataaagtca tgcgccattt tgcggttgca gaagatataa cggatattaa accagatccg       900
     atctgggaag aagcgatgat ttgttgcgaa tgtggtattt gtgaggtaat cgcttgtccg       960
     atggggcttt ccccgcgcca agtaaacatt catgtgaaaa aagagctttt aaaacaaggt      1020
     gttcgttatc aaactgataa aaaagaattt acgcctgacc cgatgcgcga ttataaatcg      1080
     attgctccaa aaaatattct aattaaaatg ggcttacagc aatatgctga tgttcattta      1140
     gaaacaatgc attatttaga tgtggatgaa gtttttatcc caacaaaaat gcatattggt      1200
     gcgccgtcta ttccagtagt aagtgaaggg gacatcgtga aaaaaggcga tttaattgcg      1260
     aaaattcctg atactgctct tggggcaaat atccatgcaa gtattgacgg tcaaattatt      1320
     cgtataaccg aagaacaagt tcatattaag agggtgatgt catga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page