(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1107

AL596167.LIN1107     Location/Qualifiers
FT   CDS_pept        163228..163782
FT                   /transl_table=11
FT                   /gene="lin1107"
FT                   /note="similar to Salmonella enterica PduT protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR4"
FT                   /protein_id="CAC96338.1"
FT                   /translation="MKMDTLGFLELNSISKGIEAVDTMLKAANSELIYAKASCPGKYYI
FT                   LIAGTVDSVAQSIEAGTKIGAANIVGNLVIPRVSDQVIKAINKTEVPDEMNAVGVMEYY
FT                   SCSGSIIAADAAVKAADVQLMDIRLATGIAGKSFVVLTGDTAACEAAVEAGLAAAKEEA
FT                   LLINKVVIPRPRKEVFESLIY"
     atgaaaatgg atacattagg atttctcgaa ttaaatagta tttcgaaagg catcgaggcg        60
     gttgacacaa tgctaaaagc ggccaactca gaattgattt atgctaaagc aagctgtcct       120
     gggaagtatt atatattaat tgccggtaca gtggattctg tagctcaatc aattgaagcg       180
     ggaacgaaga ttggtgcggc aaatatcgtt gggaacttag tcattcctcg cgtgtccgac       240
     caagtaatca aagcaattaa caaaacggaa gtgccagatg agatgaatgc agttggtgtt       300
     atggagtatt attcctgttc aggatcaatt attgctgcag atgccgcggt aaaagctgca       360
     gatgttcagc tgatggatat tcggttggcg acggggattg ctggtaaatc tttcgttgtt       420
     ttaactggtg atacagcagc atgtgaagcg gccgtggaag cgggacttgc agctgctaaa       480
     gaggaagcac ttttaattaa taaagtagtt ataccaagac ctcgtaaaga agttttcgag       540
     agtttaatct attaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page