(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1108

AL596167.LIN1108     Location/Qualifiers
FT   CDS_pept        163930..164280
FT                   /transl_table=11
FT                   /gene="lin1108"
FT                   /note="similar to Salmonelle enterica PduU protein"
FT                   /db_xref="GOA:Q92CR3"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR3"
FT                   /protein_id="CAC96339.1"
FT                   /translation="MSFDDNKERVIQEYVPGKQVTLAHLIANPNRDIYTKLGLEEGASA
FT                   IGILTITPSEASIIASDIATKSGDVRIGFIDRFSGSVVLTGDVSSVESALQQVVYSLHE
FT                   ILDFSIPKITRS"
     atgagttttg atgataataa agaacgcgta atacaagaat atgtaccggg aaaacaggtg        60
     acgctggcgc atttaatcgc caatccgaac cgtgatattt atacaaaatt aggattagaa       120
     gaaggcgcaa gtgcgattgg aattttaacg attacgccaa gtgaggcttc gattattgcc       180
     agtgacattg caactaaatc aggtgacgtt cgaattggct ttattgatcg ttttagtggg       240
     tctgttgtac ttactggtga tgtttcttct gttgaatcag ctttacaaca agttgtttat       300
     tcattacatg agattttgga cttttctatt ccaaaaatca ctaggagctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page