(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1109

AL596167.LIN1109     Location/Qualifiers
FT   CDS_pept        164286..164717
FT                   /transl_table=11
FT                   /gene="lin1109"
FT                   /note="similar to Salmonella enterica PduV protein"
FT                   /db_xref="GOA:Q92CR2"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR2"
FT                   /protein_id="CAC96340.1"
FT                   /translation="MKKMMVMGSVGCGKTTLCQKLHGYDILYKKTQAVEYFQEMIDTPG
FT                   EFVQHRQLYSALTVTSADASVIAILQSVTEKKQTFSPMFASIFAKPVIGIVTKVDLAES
FT                   DKDIERAERELRMAGAKHIFYISSVEETGIEELRAYLED"
     ttgaagaaaa tgatggtaat gggttcagtt ggttgtggta aaacaacgct gtgccagaaa        60
     ttacatggat atgatatttt atataaaaaa acacaagctg tggagtattt tcaagaaatg       120
     attgataccc caggcgaatt tgtacaacat agacaactat acagtgcgct cactgtgact       180
     tcggctgatg catcagtaat cgcgatttta caaagtgtaa cggagaagaa gcagacgttt       240
     tcaccgatgt ttgccagtat ttttgctaaa ccggttattg ggattgttac aaaagtggat       300
     ttagcggaat cggacaaaga catcgagcga gcagagcggg aattacgcat ggctggcgcg       360
     aagcatattt tttatatttc ttcggtagag gaaactggaa tagaagagct tcgggcatat       420
     ttggaagatt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page