(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1111

AL596167.LIN1111     Location/Qualifiers
FT   CDS_pept        165478..166035
FT                   /transl_table=11
FT                   /gene="lin1111"
FT                   /note="similar to bifunctional cobalamin biosynthesis
FT                   protein CopB, (cobinamide kinase; cobinamide phosphatase
FT                   guanylyltransferase)"
FT                   /db_xref="GOA:Q92CR0"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR0"
FT                   /protein_id="CAC96342.1"
FT                   /translation="MAEMMLVTGGARSGKSNFAEKEAAKYDRVLYVATGIAFQNDTEFQ
FT                   ARIKKHQATRPEHWDTFEAFKGIATYLEQHGNQYDVIMLDCVTMLVTNLFFSLLGEREL
FT                   TNEIADEVEAAIQSEVRAILKAGKQSSAKLIFVTNEIGLGVVPENKLTRVFRDIIGRIN
FT                   QQIATEVEEVYFVVSGIPKRWK"
     atggctgaaa tgatgcttgt aactggtggt gctagaagtg gtaaaagtaa ttttgctgaa        60
     aaagaagctg ccaaatatga tcgtgtttta tatgtggcga ccggaattgc atttcaaaat       120
     gatacagagt ttcaagctag gataaaaaaa catcaagcaa cccgtccaga acactgggat       180
     acttttgaag catttaaagg gattgctact tacttggagc aacatggaaa tcaatatgat       240
     gtaataatgc ttgattgcgt aacgatgtta gtaactaatt tatttttttc gttgcttggt       300
     gagcgcgagt tgacaaatga gattgctgat gaagtagaag cggcgattca atcggaagtt       360
     cgtgcaattt taaaagcagg aaagcaatcc tctgccaaac ttatttttgt tacgaacgaa       420
     attgggctag gggttgtacc tgaaaacaag ttaactcgag tatttcgaga tattattggt       480
     cgtattaatc agcaaattgc aacggaagta gaggaagttt attttgtcgt gagcggcatt       540
     ccgaaaaggt ggaagtaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page