(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1114

AL596167.LIN1114     Location/Qualifiers
FT   CDS_pept        complement(167770..168654)
FT                   /transl_table=11
FT                   /gene="lin1114"
FT                   /product="Regulatory protein similar to Salmonella
FT                   typhimurium PocR protein"
FT                   /db_xref="GOA:Q92CQ7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ7"
FT                   /protein_id="CAC96345.1"
FT                   /translation="MLLQTKSNEMLLEKVMDEFSAATSLASVVVDIHGTEVSRLCNFTP
FT                   FCQLIRSNPKYRSLCQKCDMFGGLEASKTGKPLIYRCHAGLTDFSVPIVVENQLSGFLL
FT                   SGQVICEENSEVGNIQTEETDWKNDKDLISAFRSVPVFSSKKINSSAEMLTIISQYYLK
FT                   SEMEKSREEQKQKIVFHHNKPTHHEDNKEIRKALKYIEKNLNRPITLDEVASHVYLSSY
FT                   YFSKLFKKEMNVNFINYVNQKKMSLAKDMLKNPRWSIDNVARNLGFTQTSYFCKVFRKE
FT                   FDVTPKGYRETLK"
     atgttactac aaaccaaaag caatgaaatg cttcttgaaa aagtcatgga tgagttctca        60
     gccgctacta gtctagcctc agttgttgta gatatacacg gtaccgaagt ttcaagatta       120
     tgtaacttta ctcctttttg ccaactcatt cgttctaacc caaaatatcg ctcgctttgc       180
     caaaaatgtg atatgtttgg cgggttggaa gcttctaaaa ccggaaaacc tttaatttat       240
     cgatgtcacg ctggactaac cgatttttca gttccaatcg tcgtcgaaaa tcaactaagc       300
     ggatttttgc tcagcggtca ggttatttgt gaagaaaata gtgaagttgg taatattcaa       360
     acagaagaaa ctgattggaa aaacgataaa gacctaattt ccgcgtttcg ctctgtccct       420
     gttttcagct ctaaaaaaat caattcttct gccgaaatgc ttacaattat ctcccagtat       480
     tacttgaaat ctgaaatgga aaaaagccgc gaagaacaaa aacaaaaaat cgtcttccat       540
     cacaataaac caacacatca tgaagataat aaagaaattc gaaaagcact taagtatatt       600
     gaaaaaaatc tcaatcgtcc aattacactt gatgaagttg caagtcatgt ctaccttagc       660
     tcttattact tcagtaaatt attcaaaaaa gaaatgaatg ttaattttat caattatgta       720
     aaccaaaaga aaatgtcgct cgcaaaagat atgctaaaaa atccacgttg gtcgattgat       780
     aatgttgctc gtaacttagg attcacccaa acgagctatt tctgcaaagt cttccgaaaa       840
     gagtttgatg taactccaaa aggctaccgc gaaaccttaa aataa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page