(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1115

AL596167.LIN1115     Location/Qualifiers
FT   CDS_pept        168956..169243
FT                   /transl_table=11
FT                   /gene="lin1115"
FT                   /note="similar to Salmonella typhimurium PduA protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ6"
FT                   /protein_id="CAC96346.1"
FT                   /translation="MQEALGLVETKGLVSAIEAADAMVKSANVTLTGYEKIGSGLVTVM
FT                   VRGDVGAVKAATDAGAEAARNVGTVMSTHVIPRPHTDVEEILPVRVKSDE"
     atgcaagaag cactaggttt agttgaaact aaagggctag tcagcgccat tgaagccgct        60
     gacgccatgg ttaaatcagc taacgtaaca ttaacagggt acgaaaaaat cggatccggg       120
     cttgttactg tgatggttag aggggatgta ggtgcagtta aagcagcaac agacgctggg       180
     gctgaagcag caagaaatgt aggtaccgta atgagtacac atgttattcc tcgtccgcat       240
     actgatgtgg aagaaatttt accagtgagg gtgaagtcag atgagtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page