(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1116

AL596167.LIN1116     Location/Qualifiers
FT   CDS_pept        169236..170039
FT                   /transl_table=11
FT                   /gene="lin1116"
FT                   /note="similar to Salmonella typhimurium PduB protein"
FT                   /db_xref="GOA:Q92CQ5"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030984"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ5"
FT                   /protein_id="CAC96347.1"
FT                   /translation="MSKQNKLIDEILKQVMETVNDAPEKIVEDGGSRQMSEKAVQLTEF
FT                   VGTAIGDTIGLVIANVDGQLLEAMKLEKSYRSIGILGARTGAGPHIMAADEAVKATNTE
FT                   VVKIELPRDTKGGAGHGSLIIFGGDDVSDVKRAVEVALNELDKTFGDVYGNEAGHIELQ
FT                   YTARASHALNTAFGAPVGKAFGLMVGAPAGIGVVMADTAVKSANVDVVAYSSPADGTSF
FT                   SNEVILCISGDSGAVRQAVISAREIGKKLLGALGDEPKNDRPSYI"
     atgagtaagc aaaataaact gattgacgaa attctaaaac aggtaatgga aacggtcaat        60
     gatgccccgg aaaaaatagt agaggatgga ggatcacgtc aaatgagtga aaaagcagtt       120
     caattaacag agtttgtagg aacagcgatt ggagatacaa tcggcctagt gattgcgaat       180
     gtagacggac aacttttaga agcaatgaag cttgagaagt cttaccgttc tataggtatt       240
     ttaggagccc gtactggtgc aggcccacat attatggcag cagatgaagc tgtaaaagca       300
     acgaatacag aagtagtaaa aatcgaatta ccacgtgata caaaaggcgg tgcaggtcac       360
     ggttctttaa ttatctttgg tggtgatgat gtttctgatg ttaaacgcgc agtggaagtt       420
     gcactgaatg aattagataa aacttttgga gatgtatacg gtaacgaagc agggcatatt       480
     gaactccaat ataccgctcg cgcaagccac gcacttaata cagcatttgg cgcaccagta       540
     ggtaaagcat ttggacttat ggttggtgca ccggctggaa ttggcgttgt tatggctgat       600
     actgcggtga aatctgccaa tgtagatgtg gttgcttatt cttcaccagc agatggaaca       660
     agtttctcca atgaagtgat tctttgtatt tcaggagatt ctggcgcagt tcgtcaagca       720
     gttatttcag cacgtgaaat tggtaaaaaa ttacttggag ctttagggga tgaaccgaaa       780
     aatgatcgtc catcctacat ttag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page