(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1117

AL596167.LIN1117     Location/Qualifiers
FT   CDS_pept        170058..171722
FT                   /transl_table=11
FT                   /gene="lin1117"
FT                   /note="highly similar to propanediol dehydratase, alpha
FT                   subunit"
FT                   /db_xref="GOA:Q92CQ4"
FT                   /db_xref="InterPro:IPR003206"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036999"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ4"
FT                   /protein_id="CAC96348.1"
FT                   /translation="MKSKRFEELAKRPVNQDGFVKEWIEEGLIAMESPNDPKPSIKIEN
FT                   GKVVEMDSKKLADFDLIDHFIAKYGVDLSRAEEVMKMDSVKLANMLCDPNVPREKIVLL
FT                   TTAMTPAKIVEVVSQMNVVEMMMSMQKMRSRRTPTTQAHVTNLRDNPVQIAADAAEAAI
FT                   RGFDEQETTVAVVRYAPFNALSLLVGSQTGRGGVLTQCSLEEATELELGMRGLTCYAET
FT                   ISVYGTEPVFTDGDDTPWSKGILASAYASRGLKMRFTSGTGSEVQMGYAEGKSMLYLES
FT                   RCIFITKAAGVQGLQNGSISCIGIPGAVPSGIRAVLAENLIAVMLDLEVASGNDQTFSH
FT                   SDIRRTARLLMQFLPGTDYISSGYSATPNYDNMFAGSNFDADDFDDYNILQRDLKVDGG
FT                   LTPVTEEEVVAVRNKAARVIQVVFDKLGLPAVTDEEVEAATYARGSNDMPERNMVEDIK
FT                   AAAEMMDRGVTGLDVVKALAAGGFDDVAESVLNMLKQRVSGDFLHTSAIIDKDWNVISS
FT                   VNDLNDYAGPGTGYRLEGERWEKLKDIAVAVDANELD"
     atgaaatcaa aacgctttga agaattagca aaacgcccgg tcaatcaaga tggttttgta        60
     aaagaatgga ttgaagaagg cttaatcgca atggaaagtc caaatgaccc aaaaccaagc       120
     attaaaatag aaaatggaaa agtagtcgaa atggacagca aaaaattagc tgattttgac       180
     ttaattgacc attttatcgc taaatatggc gtcgatttat ctcgtgcaga agaagttatg       240
     aaaatggatt ctgttaagct tgcaaacatg ctttgcgacc caaatgtacc acgggaaaaa       300
     atcgttttac ttacaacagc aatgacaccg gcaaaaatag ttgaagtagt ttcacaaatg       360
     aacgttgtcg aaatgatgat gtccatgcaa aaaatgcgct cacgtagaac accgacaacg       420
     caagctcacg taactaactt acgtgataac cctgttcaaa ttgcagcaga tgcagcagag       480
     gcagcaattc gtggttttga cgagcaagaa acaaccgttg ctgtagttcg ttatgcacct       540
     ttcaacgcac ttagcttatt ggtaggttcg caaacaggcc gtggtggcgt attaacccaa       600
     tgttctcttg aagaagcaac agaattagag cttggtatgc gcggtttaac ttgttacgct       660
     gaaacgattt ctgtttatgg tacagaacct gtatttacag acggagatga tacgccttgg       720
     tccaaaggta ttttggcaag tgcttatgcg tctcgcggtc taaaaatgcg tttcacatct       780
     ggaactggtt ctgaggttca aatgggttat gcagaaggaa aatcgatgct ttatctagaa       840
     tctcgctgta tcttcattac gaaagcggct ggtgttcaag gtttacaaaa tggttcgatt       900
     agttgtatcg gaattccggg agccgtacca agtggtatta gagcagttct tgcagagaat       960
     ttaattgccg ttatgttaga tctagaagta gcttctggta acgaccaaac tttctctcac      1020
     tcggatattc gccgtacagc tcgtttgctg atgcaatttt taccaggaac tgattacatt      1080
     tcatctggat atagtgcgac tccaaactat gacaatatgt ttgcgggttc caattttgat      1140
     gcagatgatt ttgatgatta caatatttta caacgtgatt taaaagtaga tggtggttta      1200
     acgccagtga cggaggaaga agttgtagcg gttagaaata aagctgcacg agtaatccaa      1260
     gttgtctttg ataaattagg tcttcctgct gtaacggatg aggaagtaga agcagcaacc      1320
     tatgcacgtg gaagtaacga tatgccagaa cgtaacatgg tagaagatat taaagcagca      1380
     gcagaaatga tggaccgcgg cgtaactggt ctggatgttg taaaagcatt agctgctggt      1440
     ggatttgacg atgttgccga aagcgtacta aacatgctga aacaacgcgt atctggagac      1500
     ttccttcata catctgccat cattgataaa gactggaatg tcattagttc cgtcaacgat      1560
     ttaaatgatt acgcaggccc aggaactggt tatcgcttag aaggcgaacg ctgggaaaaa      1620
     ttaaaagata ttgctgttgc agttgatgca aacgaattag attaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page