(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1118

AL596167.LIN1118     Location/Qualifiers
FT   CDS_pept        171760..172419
FT                   /transl_table=11
FT                   /gene="lin1118"
FT                   /note="similar to diol dehydrase (diol dehydratase) gamma
FT                   subunit"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="InterPro:IPR025541"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ3"
FT                   /protein_id="CAC96349.1"
FT                   /translation="MVEINEKVLRGIISEVLDELQLKEDKVSFQKEQPSVAVSDESFLT
FT                   EVGDAKPGRQKDEVVIAVAPAFGKYQTKNIVGVPHKQILREVIAGIEEEGLKARVVRVF
FT                   RSSDVAFVAVEGDKLSGSGICIGIQSRGTALIHQKDLQPLSNLELFPQAPLITLETYRA
FT                   IGKNAAKYAKGESPNPVPMVNDQMARPKFQAKAALLHIKETKHVVQGKNAVELQVN"
     atggttgaaa ttaacgaaaa agtgcttcgc ggaattatct cagaagtact agatgaatta        60
     cagcttaaag aagataaagt ttctttccaa aaagaacagc caagtgttgc agtttcagat       120
     gaaagctttt taacagaagt tggggatgcg aaaccaggaa gacaaaaaga tgaagttgtt       180
     attgcggtcg caccagcttt tggtaaatat caaacgaaaa acattgttgg cgttccacat       240
     aaacagattt tacgagaagt gattgcaggc attgaagaag aagggttaaa agcacgcgtt       300
     gttcgtgtat tccgttcttc tgatgtagct ttcgtcgcag tagaaggcga caaattaagt       360
     ggttcaggca tttgtatcgg cattcagtcg cgcggtacag cattaatcca tcaaaaagat       420
     ttacaaccac tttcgaacct agagttattc ccacaagcac cactaatcac actagaaact       480
     taccgggcaa ttggtaaaaa cgctgcgaaa tatgcaaaag gtgaatcacc aaatccagtc       540
     ccaatggtaa atgatcaaat ggctcgtcca aaattccaag caaaagcagc tttacttcat       600
     atcaaagaaa cgaaacatgt tgttcaaggt aaaaacgcag tcgaactaca agtaaattaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page