(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1119

AL596167.LIN1119     Location/Qualifiers
FT   CDS_pept        172436..172948
FT                   /transl_table=11
FT                   /gene="lin1119"
FT                   /note="similar to diol dehydrase (diol dehydratase) gamma
FT                   subunit (pddC)"
FT                   /db_xref="InterPro:IPR003207"
FT                   /db_xref="InterPro:IPR036091"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ2"
FT                   /protein_id="CAC96350.1"
FT                   /translation="MNQEALENMVRNILQEVNSGAVTTTTSQKASGDSLTVRDYPLGTK
FT                   RPELVKTASSKSLDDITLKSVLDGTIKPEDVRVTAETLKMQAQVARDAGRATLANNFER
FT                   AAELTVVPDERILEIYNAMRPYRSSREELLAIADELENVYQATICSNYVREAAQLYQER
FT                   KKLKGDN"
     atgaatcaag aagcactaga aaatatggtt agaaatattt tacaagaagt aaatagtggt        60
     gcagtaacaa caaccacttc tcaaaaagca agcggagatt cactgactgt acgcgactac       120
     ccactcggta cgaaacgtcc agaacttgta aaaacagctt catctaaatc tttggatgat       180
     attacgctaa aaagtgttct agatggcaca attaaacctg aagatgttcg tgtaacagca       240
     gagacgctta aaatgcaagc gcaagtagca agagatgcag gacgtgctac actcgcgaac       300
     aactttgaac gtgcagcaga attaaccgtt gttccagatg agcgtatttt agaaatttac       360
     aatgcgatgc gtccttaccg ttcttcaaga gaagaattgc ttgcgattgc ggatgaatta       420
     gaaaatgtgt atcaagcaac aatttgttct aattatgttc gtgaagcagc acagctttat       480
     caagagcgta agaaattaaa aggcgataat taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page