(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1120

AL596167.LIN1120     Location/Qualifiers
FT   CDS_pept        172993..174813
FT                   /transl_table=11
FT                   /gene="lin1120"
FT                   /note="similar to diol dehydratase-reactivating factor
FT                   large subunit "
FT                   /db_xref="GOA:Q92CQ1"
FT                   /db_xref="InterPro:IPR009191"
FT                   /db_xref="InterPro:IPR028975"
FT                   /db_xref="InterPro:IPR030994"
FT                   /db_xref="InterPro:IPR040916"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ1"
FT                   /protein_id="CAC96351.1"
FT                   /translation="MKYIAGIDIGNSTTEVALAILDSVNNAEFVASAITDTTGIKGTKQ
FT                   NLHGIFKALKLALEKVNATTADLAEIRINEATPVIGDVAMETITETIITESTMIGHNPK
FT                   TPGGLGMGSGITVHLDEVASKSKDTDYIVIIPKTVDFEDAAQQINDYTELGYQITAAIL
FT                   QADDGVLVHNRLNHKIPIVDEVGFIDKVPVDMLAAVEVAAPGKVIETISNPYGIATVFR
FT                   LSSDETKNIIPVARALIGNRSAVVIKTPEGDVKARTIPAGHIELQSGTRTQRVNVAEGS
FT                   EKIMQAIMSLPKLDNASGEPGTNIGGMLEKVRQTMAGLTDKLPADIFIQDLLAVDTFVP
FT                   VDVQGGLAGEFSMEQAVGIASMVKSDHLQMAAIASEIEQELNVTVKIGGAEAEAAILGA
FT                   LTTPGTNTPLAILDLGAGSTDASIINGKGEIIATHLAGAGDMVTMIIQSEIGLEDRYLA
FT                   EDIKKYPLAKVESIFHIRHEDGTVQFFDTPLSPSVFAKVVIVKPDGFVPIPGDVSIEKI
FT                   KLIRRSAKERVFVTNTIRALKYVSPTGNIRDIPFVVIVGGSALDFEIPQLITDALSHYS
FT                   LVAGRGNIRGQEGPRNAVATGLILSGGANV"
     atgaagtata ttgcaggtat tgatatcgga aactcgacaa ctgaagtggc gcttgccatc        60
     ctcgactcgg taaataatgc ggagtttgtt gctagcgcta ttacagacac aactggtatc       120
     aaaggaacaa aacaaaatct tcatgggatt tttaaagcgt taaaactagc tttagaaaaa       180
     gtaaatgcaa caactgcgga tttagctgaa attcgtatta atgaagcgac tcccgtgatt       240
     ggtgatgtag caatggaaac aattactgaa acaattatca cagagtctac catgattggg       300
     cataatccta aaacaccagg tgggcttgga atgggttcag gaattacagt acatttggat       360
     gaagtggctt ctaaatcaaa agatactgat tatatcgtga ttatcccaaa aacggttgac       420
     tttgaagatg ccgcacagca gattaatgat tataccgaac ttggctatca aataactgct       480
     gcgatccttc aagcagacga cggggtgctc gttcataatc gattaaacca taaaattccg       540
     attgtagatg aagttggttt tattgataaa gttccagttg atatgttagc ggctgttgaa       600
     gtcgcagctc ctggtaaagt cattgaaacg atttctaatc cgtatggtat tgcgacagtc       660
     ttccgtttga gttctgatga aacgaagaac atcattcccg tagctcgagc attaattggt       720
     aatcgttcag cagttgtgat taaaacacca gaaggcgacg taaaagctag aacaatacca       780
     gccggacata ttgaacttca atcaggaact agaacgcagc gtgtaaatgt ggcggaaggt       840
     tccgagaaaa tcatgcaagc gattatgtca ctgccaaaac ttgataatgc aagcggcgaa       900
     ccgggaacaa atatcggcgg catgctagaa aaagtacgac aaaccatggc tggacttact       960
     gataaattac cggcagatat ttttattcaa gatttgctgg ctgtagatac gtttgttcca      1020
     gtagatgttc aaggtggtct ggcgggtgaa ttttccatgg agcaagctgt tggaattgcc      1080
     tcaatggtaa aaagtgatca tttacaaatg gctgcgattg cctcagaaat cgaacaagag      1140
     ctaaatgtaa cggtcaaaat tggtggggca gaagctgagg cagcgattct cggggcactt      1200
     actaccccag gaaccaatac accacttgct attttagact taggagcagg ttcaacagat      1260
     gcttcaatca taaatggaaa aggcgaaatc attgctactc atttagctgg agcaggtgat      1320
     atggtaacga tgattatcca gtcagaaatt ggccttgaag atcggtattt agcagaagat      1380
     ataaaaaaat atccacttgc taaagtcgaa agcatttttc atattcgcca tgaagatggt      1440
     acggttcaat ttttcgatac gccgctttcc ccaagtgttt ttgcgaaagt agtgattgta      1500
     aaaccagatg gatttgtacc aattccaggt gacgtttcga ttgaaaaaat taaattaatt      1560
     cgtcgttcgg ctaaagagcg cgtttttgta acgaatacga tccgtgcatt aaaatatgtc      1620
     agcccaactg ggaacattcg tgatattcca tttgtcgtta ttgtcggagg atcagccctt      1680
     gattttgaga ttccgcaatt aatcacagat gcactttctc attattcctt agttgcggga      1740
     cggggaaata ttcgcggaca agaagggcca agaaatgcgg ttgcaacagg attaattctg      1800
     tcgggtggtg ctaatgtatg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page