(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1122

AL596167.LIN1122     Location/Qualifiers
FT   CDS_pept        175170..175607
FT                   /transl_table=11
FT                   /gene="lin1122"
FT                   /note="similar to Salmonella enterica PduK protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP9"
FT                   /protein_id="CAC96353.1"
FT                   /translation="MHQAIGIIEIKGLASAITVADTMAKVANIQIVDTEKAKGFGWITV
FT                   KVEGDVAAVNAALEAGEQTAIASDSFVAKKVIPRPGEEIFTVFLPKEEIVPEEPELIVE
FT                   TEDVAEPETPVEATCNLCHDPLCPRIKGDPRQDCIHFEEEK"
     atgcatcaag caattggaat tattgaaatt aaaggacttg cttcagcgat tactgtagca        60
     gatacaatgg ctaaagtagc aaatatccaa atcgtggaca cagaaaaagc aaaaggtttt       120
     ggctggatta ctgtgaaagt ggaaggagac gttgctgccg tcaatgccgc tcttgaagca       180
     ggagaacaaa cggcaatagc ctcagacagc tttgttgcga aaaaagtcat tcctcgacca       240
     ggggaagaga tttttacagt atttttgcca aaagaagaaa tcgtgccaga agaacctgaa       300
     ttaattgttg aaacagaaga cgtcgcggaa cctgaaacac cggtagaagc gacctgtaat       360
     ctatgtcatg atccactttg tccacggata aaaggtgatc caagacaaga ttgtattcat       420
     tttgaagaag aaaagtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page