(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1124

AL596167.LIN1124     Location/Qualifiers
FT   CDS_pept        175912..176547
FT                   /transl_table=11
FT                   /gene="lin1124"
FT                   /note="similar to Salmonella enterica PduL protein"
FT                   /db_xref="GOA:Q92CP7"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP7"
FT                   /protein_id="CAC96355.1"
FT                   /translation="MEREELKAIIKKIVTDKYGGAETEIPIGVSNRHIHLTEKDYNQLF
FT                   PNEPIQVKKWLKQPGEFAAEQTLTVVSERGELKRVRILGPLRKFSQVELSKTDARMLGM
FT                   KIPIRVSGDIEGTPGIKLVSKHNEIFLPKGAIVAKRHIHLPESVANEYGVKQGDEVSVL
FT                   VGSEIRSLVLNHCTIRVNNQFIPEMHIDTDEANAADIAGDSFAKIIKS"
     gtggaaagag aagaattaaa ggcaataatt aagaaaatcg taacagataa atatggtggt        60
     gcggagacag agattccaat cggagtctct aaccgccaca ttcatttaac agaaaaagac       120
     tataaccaac tttttccaaa tgaacctatt caagtgaaaa aatggttaaa gcaacctggc       180
     gaatttgctg ctgaacaaac tctcaccgta gtttcagaaa gaggcgagtt aaagcgggtt       240
     cggattttag gtccgcttcg aaaattttcg caagtagagc tttctaaaac agatgcacgg       300
     atgttaggga tgaagattcc aattcgtgta tctggtgata ttgaaggaac accagggatc       360
     aaactcgttt ctaaacataa cgaaatcttc ttaccaaaag gagcaattgt tgcgaaacgc       420
     catatccatt tacccgaaag tgtagcaaat gaatacggtg tgaaacaagg tgatgaagtt       480
     tctgtcctag taggttcgga aatacgtagt ctcgtgttaa accattgtac gattcgagtg       540
     aataatcaat ttatcccaga aatgcatatt gatacagatg aagcaaacgc ggcagatatt       600
     gctggcgata gctttgcaaa aataatcaag tcgtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page