(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1125

AL596167.LIN1125     Location/Qualifiers
FT   CDS_pept        176568..177407
FT                   /transl_table=11
FT                   /gene="lin1125"
FT                   /note="similar to ethanolamine utilization protein EutJ"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP6"
FT                   /protein_id="CAC96356.1"
FT                   /translation="MDILQTANERMEQLAALMNKDTKQKVSADQKVKVGVDLGTSSIVF
FT                   VVLDENNVPLFGAFEFADAVRDGLVVNYRESVEVVKRLKDRAEKSLGISLTHASGAIPP
FT                   GTIGNNKKVVANVIESAGMEALYTIDEPTAAAAVLDLKDGAVVDVGGGTTGISVFKDGD
FT                   VIYTADEPTGGTHMTLVLAGYYGVSVEEAEENKRAQKDSSEHFSVMRPVVEKMAEITRV
FT                   HLEKSPSEPLYIVGGASAYSQFKDTFESYLKMPVFQPNYPQYVTPLGIAMSSGSGNL"
     atggatattt tacaaacagc taacgaacgg atggaacagc ttgcagcact aatgaataaa        60
     gataccaaac aaaaggtttc agcggatcaa aaagtaaaag ttggcgtcga tttagggact       120
     tcctcgattg ttttcgttgt gttggatgaa aataatgttc cgctttttgg agcgtttgaa       180
     tttgctgacg ctgttcgcga tgggcttgtt gttaattacc gcgagtccgt agaagttgtc       240
     aaacgactta aagatagagc agaaaaaagc cttggaataa gtttaacgca tgcttctgga       300
     gctattccac ctggtacaat cgggaacaac aaaaaagtgg ttgctaacgt gatagaaagc       360
     gccggaatgg aagcacttta tacaattgac gaaccaacag ccgctgcagc agtactagat       420
     ttaaaagatg gtgcagttgt agatgttggt ggtggcacaa caggaattag tgtttttaaa       480
     gacggtgacg taatttatac cgcagatgaa ccaaccggag gaacgcatat gacacttgtt       540
     ctagcaggat attacggtgt ctctgtagaa gaagctgaag aaaataagcg cgcgcaaaaa       600
     gattctagcg agcatttttc tgtcatgcgt ccagtagttg aaaaaatggc agaaatcacc       660
     cgtgttcatc tcgaaaaatc tccctcagaa ccgctttata ttgttggtgg tgcttctgct       720
     tatagccagt tcaaagatac gtttgaaagc tatttgaaga tgcctgtttt tcaacctaat       780
     tatccgcagt atgtcacgcc tcttggtatt gccatgagtt cagggagcgg aaatttatga       840
//

If you have problems or comments...

PBIL Back to PBIL home page