(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1127

AL596167.LIN1127     Location/Qualifiers
FT   CDS_pept        177888..178151
FT                   /transl_table=11
FT                   /gene="lin1127"
FT                   /note="similar to carbon dioxide concentrating mechanism
FT                   protein "
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP4"
FT                   /protein_id="CAC96358.1"
FT                   /translation="MFMAKITGSVVSTKKEDSLTGKKLMIVQPIDANGEHVRSEEVACD
FT                   SVGAGIGEYVLVARGNAARSVFAEPNSAIDSAIIAIVDSFDK"
     atgtttatgg cgaaaattac tggaagcgta gtctcgacaa aaaaagaaga ttcgcttaca        60
     ggcaagaaat taatgattgt acaaccaatt gatgcgaacg gagaacatgt gcgctcagaa       120
     gaagtggcat gtgactctgt tggcgctgga atcggggagt atgtgcttgt tgctcgtgga       180
     aatgcggcta ggagcgtatt tgcagaacca aatagtgcga ttgattcggc aattatagca       240
     attgtcgata gttttgataa gtaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page