(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1128

AL596167.LIN1128     Location/Qualifiers
FT   CDS_pept        178166..179161
FT                   /transl_table=11
FT                   /gene="lin1128"
FT                   /product="hyghly similar to Salmonella enterica PduO
FT                   protein "
FT                   /db_xref="GOA:Q92CP3"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR009221"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP3"
FT                   /protein_id="CAC96359.1"
FT                   /translation="MSIYTKTGDKGTTALFDGNRVKKYDDRVETYGSFDELNAEISVAE
FT                   KFVTSHENKTLLRNVERQLFYVCAELATEDESALASKIVITEDDINELEKVIDAYTLKL
FT                   PKVDSFVLPGSSKAGAFLHSARTIARRAERLLVRFSEQTAVRNELLKFVNRLSDFLYIL
FT                   AREEDFRQMLDKATKLIVAKYLEQTEQKPSTTSDLSFSFCEKLMHQVQVVSEEVGVPVT
FT                   LAIVDAHGNARFNYRMEHALLVSAELATKKAYSAVAMKTSTEKLTEAVQPGAPLYQLET
FT                   LTNGDIVTFGGGVPIYGKDGAIIGGMGISGGSVEEDIHIAKKALSMIEKG"
     gtgagtattt atacaaaaac cggcgataaa ggaacgactg cactatttga tggaaatcgt        60
     gtgaaaaaat atgatgaccg tgtcgaaaca tatggttcgt ttgatgagct aaatgccgaa       120
     attagtgtag cagaaaagtt cgttacctcg catgaaaaca agactttgct tagaaacgtt       180
     gagcgccaat tgttttacgt ttgtgcagag cttgcaacag aagatgaatc tgcgcttgct       240
     agtaaaattg tcattacaga agatgacatt aacgaacttg aaaaagttat tgatgcttat       300
     actctgaagt tgccaaaagt tgatagtttt gtgcttcctg gttcaagtaa agccggcgcg       360
     tttcttcata gtgcgcggac gatagccaga cgagcggaac gattattagt tcgtttttca       420
     gaacaaacag cagttagaaa tgagctgttg aaattcgtca atcgtttatc tgatttcttg       480
     tatattcttg ctcgagaaga agactttaga cagatgctag ataaagcgac taagctaatt       540
     gttgccaagt acttagagca aacagaacaa aagcctagta cgacgagcga tttatctttt       600
     tcattttgtg aaaaactaat gcatcaggtg caggttgtct cagaagaagt cggcgttcca       660
     gtcacacttg caatagttga tgcgcacgga aatgcaagat ttaattaccg aatggaacac       720
     gctctcttag taagtgcaga actagcaacg aaaaaagcat attccgccgt agcgatgaaa       780
     acaagtacag aaaaattaac agaagcagtt cagccaggag ccccacttta tcaattagaa       840
     acactgacaa atggtgacat tgttaccttt ggcggaggcg ttccaattta cggaaaagat       900
     ggagcgatta ttggtggaat gggaattagt ggcggatcag tggaagaaga tatccacatt       960
     gcaaaaaaag cattatcaat gatagagaag gggtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page