(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1129

AL596167.LIN1129     Location/Qualifiers
FT   CDS_pept        179168..180577
FT                   /transl_table=11
FT                   /gene="lin1129"
FT                   /note="similar to ethanolamine utilization protein EutE"
FT                   /db_xref="GOA:Q92CP2"
FT                   /db_xref="InterPro:IPR012408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP2"
FT                   /protein_id="CAC96360.1"
FT                   /translation="MESLELEQLVKKVLLEKLAEQKEVPTKTTTQGAKSGVFDTVDEAV
FT                   QAAVIAQNCYKEKSLEERRNVVKAIREALYPEIETIATRAVAETGMGNVTDKILKNTLA
FT                   IEKTPGVEDLYTEVATGDNGMTLYELSPYGVIGAVAPSTNPTETLICNSIGMLAAGNAV
FT                   FYSPHPGAKNISLWLIEKLNTIVRDSCGIDNLIVTVAKPSIQAAQEMMNHPKVPLLVIT
FT                   GGPGVVLQAMQSGKKVIGAGAGNPPSIVDETANIEKAAADIVDGASFDHNILCIAEKSV
FT                   VAVDSIADFLLFQMEKNGALHVTNPSDIQKLEKVAVTDKGVTNKKLVGKSATEILKEAG
FT                   IACDFTPRLIIVETEKSHPFATVELLMPIVPVVRVPDFDEALEVAIELEQGLHHTATMH
FT                   SQNISRLNKAARDMQTSIFVKNGPSFAGLGFRGEGSTTFTIATPTGEGTTTARHFARRR
FT                   RCVLTDGFSIR"
     atggaatcat tagaactcga acaactggta aaaaaagttc tcttagaaaa attagcagaa        60
     caaaaagaag taccaacaaa aacaactaca caaggcgcga aaagtggcgt ttttgataca       120
     gttgacgagg ctgttcaagc agcagttata gcgcagaatt gctataaaga aaaatcactt       180
     gaagaacgcc gcaatgttgt aaaagcaatt cgtgaagcac tttatccaga aattgaaaca       240
     attgcgacaa gagcagttgc agagactggt atgggaaatg tgacagataa aattttgaaa       300
     aacacgttag caatcgaaaa aacgccaggg gtagaagatt tatatacaga agtagctaca       360
     ggtgataacg gtatgacact atatgaactc tctccgtatg gcgtaattgg tgcagtagcg       420
     ccgagcacaa acccaacgga aacattgatt tgtaattcaa tcggtatgct cgcagctgga       480
     aatgccgttt tttatagccc tcatccaggg gcaaaaaaca tttcactgtg gttgattgaa       540
     aaactaaaca caattgttcg cgatagttgt ggtatagata atctaattgt caccgtggct       600
     aaaccatcca tccaagcagc tcaagaaatg atgaaccatc caaaagtacc gctacttgtt       660
     attacaggtg gtccgggcgt tgttctccaa gcgatgcaat caggtaaaaa agtgattgga       720
     gcaggagcag ggaacccgcc ttctattgtt gacgaaacag ctaatatcga aaaagcggct       780
     gctgacatcg tagacggagc atcttttgac cataatattt tatgtattgc tgaaaaaagt       840
     gtggtagctg ttgatagcat tgctgatttc ttgttattcc aaatggaaaa aaatggtgcc       900
     cttcatgtta ctaatccaag tgatattcaa aaattagaaa aagtagccgt taccgataaa       960
     ggtgtaacta ataaaaaatt agtcggaaaa agtgcaactg aaatcttaaa agaagcagga      1020
     atagcttgtg attttacacc acgtttaatc attgtggaaa cggagaaatc tcatccattt      1080
     gcaacagtag agctattaat gccaatcgtt ccagttgtaa gggtgcctga ttttgacgaa      1140
     gcccttgaag tggctattga actcgaacaa ggcttacatc atacagcaac aatgcattca      1200
     caaaatatct cgagattaaa caaagctgca agagatatgc aaacttccat ctttgtcaaa      1260
     aatggtccgt cctttgcggg attaggcttt agaggagaag gtagtactac tttcactatt      1320
     gcaacgccta ctggagaagg aacaactaca gcacgtcatt ttgctagacg ccgccgctgt      1380
     gttttaacag atggtttttc gattcgttaa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page