(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1134

AL596167.LIN1134     Location/Qualifiers
FT   CDS_pept        184793..185668
FT                   /transl_table=11
FT                   /gene="lin1134"
FT                   /note="similar to Salmonella enterica PduX protein"
FT                   /db_xref="GOA:Q92CN7"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012363"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN7"
FT                   /protein_id="CAC96365.1"
FT                   /translation="MEIKATCPASCGELLQGFITGGEKLISYPINWYSEVTLSDKSGQN
FT                   SQGHTKAWLAFEVTCEYFGVTKKERPPISLLVKSTIPVAKGMASSTADIAATIGATAKW
FT                   LNKPITETEIAKLCLQLEPTDSTIFKSLTLFDHLKGSVIESSNWMPKLGVVVLEPLTVL
FT                   ETATYRQEDHHEQLLENEQQLAKAVQFFNQAAAQKSINLLGKAATVSAASNQIILPKPF
FT                   WNELLEVVSCLNLVGINVSHSGTVVGLLYELGKIDPLEILFELERRYVTTFYSRYYFRE
FT                   LVRGGVQIIS"
     gtggaaatta aagcaacttg tcccgcttca tgtggcgaac ttttgcaagg atttattact        60
     ggcggcgaaa aattgatttc atacccaatc aactggtatt ccgaagtaac tttatccgat       120
     aaatcagggc aaaacagcca aggtcataca aaagcatggc tcgcattcga ggtaacttgc       180
     gagtattttg gcgtgacaaa aaaagaacgt ccacctatat cgttactagt aaaatcgact       240
     attccggtcg ccaaagggat ggcaagctct actgctgata ttgccgcaac aataggggct       300
     acagcaaaat ggttaaataa accgataaca gaaaccgaaa ttgccaaact ttgtttacaa       360
     ctagaaccaa cagatagcac gatttttaaa tcactcacac tttttgatca tttaaaaggg       420
     tccgtgattg aaagttctaa ctggatgccg aaactgggcg tcgttgtcct agaaccactt       480
     actgttttgg aaactgcaac atatcggcaa gaagaccacc atgaacaatt gctggaaaat       540
     gaacaacaat tagccaaagc tgtgcaattt ttcaaccaag cggcagccca aaaatcaatc       600
     aacttgcttg gaaaagccgc cacagttagc gcagcgagca atcaaatcat tttacccaaa       660
     ccgttttgga atgagttgtt agaagtggtg agttgtttaa atctagtagg gatcaatgtg       720
     tcgcatagtg ggacggtcgt tggtttactg tatgagttag gtaagataga cccgctagaa       780
     attttattcg aattagaacg acgctatgtc accacttttt acagcaggta ttactttagg       840
     gagctcgttc gaggtggggt tcaaataatt tcataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page