(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1137

AL596167.LIN1137     Location/Qualifiers
FT   CDS_pept        188247..189704
FT                   /transl_table=11
FT                   /gene="lin1137"
FT                   /note="similar to two-component sensor histidine kinase"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN4"
FT                   /protein_id="CAC96368.1"
FT                   /translation="MTKTIREMCLRYTDLAEYDIDELIHTAKSLSESSMYQDVDVFIDV
FT                   YNKLTSEALVIHHTPPKSTKSLYKNNVVGETALRSNEPGVLRTLETGMNSNDLLAKTQE
FT                   NVLIRQKVYPIRNKQRVIAVLILENDISAEIKAHFEIDNEETAYRDVSTTLSAMSKLTD
FT                   SITDQLDDAILIFDRNGILQQKNCAADQYYERLGYMENIQGMHYDNLSLDQMMFDAIMY
FT                   QIETGKQPVQLKKEVVIAGNYFIMKQIFVKEEDEQECRFILILHDVTDIKVKEAEIVSK
FT                   SVAIREIHHRVKNNLQSVVSLLRIQGRRSTSVEAQKVLNESVSRILAIAATHELLSKQM
FT                   EDGINLYMVIEAVAYNIERCCNDCPQVAVRMDIDKRIYLDSDRTVALALVMNELLQNSY
FT                   DHAFHPNESGEILLQIKEEKNIIHAEVSDNGHGFNVRKVSEKSLGLSIVKSYIKDKLRG
FT                   KVTIESNEHGTKTMFDFKYNSIHATKK"
     atgactaaga cgattcgaga aatgtgttta cgctatacgg acttggcaga atatgatatt        60
     gatgaattaa tacatactgc aaaatcgtta agcgagtctt ccatgtatca agatgtagat       120
     gttttcattg atgtttataa caaacttact agtgaagcac ttgttattca tcatacgccg       180
     ccaaaatcaa ccaagtcact ttataaaaac aatgtagttg gagaaactgc tcttcggagt       240
     aatgaacctg gtgtacttag aacacttgaa acaggtatga actccaacga cttgcttgcc       300
     aaaacacaag aaaacgtatt aattcgtcaa aaagtgtatc ctatccgtaa caaacaacga       360
     gtcattgccg tacttattct agaaaatgat attagtgcag aaattaaagc tcattttgaa       420
     atcgacaatg aagaaacagc ctatagggat gtttctacaa cactttccgc gatgagtaaa       480
     ttaaccgatt ctattactga tcaactagat gatgcaatct tgatttttga tcgtaacggt       540
     attttacaac aaaaaaactg cgctgctgac cagtattatg aacgactcgg ctacatggaa       600
     aatatccaag gaatgcatta tgataattta tctctcgacc agatgatgtt tgatgcaatt       660
     atgtatcaaa tcgaaacggg aaaacagcca gttcaattaa aaaaagaagt ggttattgcc       720
     gggaattact ttattatgaa gcaaattttt gtgaaagaag aggatgaaca agaatgtcgt       780
     tttatcctta tcttacatga tgtcacggat attaaagtga aagaagcgga aatcgtttca       840
     aaatcggtgg caattcgcga aattcatcat cgtgtgaaga ataatctaca atcagttgtt       900
     tcactgctga gaattcaagg cagacgttct acaagcgtgg aagcacagaa ggttttgaat       960
     gagagtgtca gtcgtatcct tgcaattgca gctacacatg aacttttatc caagcagatg      1020
     gaagacggca tcaacttata tatggtaatt gaagcagtcg cctataatat tgaaagatgt      1080
     tgtaacgatt gtccgcaagt tgcagttaga atggatattg ataaacggat ttacttggat      1140
     agtgaccgaa ccgtggcact agcacttgtt atgaatgaac tactacaaaa ttcatatgat      1200
     catgctttcc atccaaatga atcaggcgaa attttactac aaataaaaga agaaaaaaat      1260
     attattcacg cagaagtaag cgataatggt catggcttta atgttcggaa agtatccgaa      1320
     aaaagcctag gactttccat tgtcaaaagt tacatcaaag ataaactgcg cggtaaagta      1380
     acaattgaat caaatgaaca tggaactaaa acaatgttcg attttaaata caattcaatc      1440
     catgctacaa agaagtag                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page