(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1141

AL596167.LIN1141     Location/Qualifiers
FT   CDS_pept        193546..194199
FT                   /transl_table=11
FT                   /gene="lin1141"
FT                   /note="similar to putative carboxysome structural protein
FT                   (eutL)"
FT                   /db_xref="GOA:Q92CN0"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN0"
FT                   /protein_id="CAC96372.1"
FT                   /translation="MKNDKLPASVLSVKVVSNVDNGLFKQLDLKPHQRSLGIITSDCDD
FT                   VTYTALDEATKAAEVDVVYAKSMYAGAGNASTKLAGEVIGIIAGPSPAEVKSGLSVAVD
FT                   FIENGASFVSANEDDSVPYFAHCVSRTGSFLSKEANVAEGQAIAYLIAPPLEAMYALDA
FT                   ALKAADVAIGTFYGPPSETNFGGALLTGSQSACKAACDAFKMAVENVAENPLQY"
     atgaaaaacg ataaattacc tgcatccgtt ttaagcgtca aagttgtatc taatgtagac        60
     aatggtttat ttaaacaact tgacttaaaa ccgcatcaaa gaagtctggg tattattaca       120
     tctgattgtg atgatgttac atacacagca cttgatgaag caacaaaagc agcagaagta       180
     gatgttgtct atgcgaaaag tatgtatgct ggtgctggaa atgcatccac aaaactagct       240
     ggtgaagtaa tcggtattat tgccggacca agcccagctg aagtaaaaag tggcctttca       300
     gttgcagtag acttcatcga aaatggcgct agctttgtta gtgcaaatga agatgatagc       360
     gtaccttact ttgcacattg tgtatcaaga acaggttctt tcctttcaaa agaagcaaat       420
     gtagcagaag gacaagcgat tgcttactta atcgcaccgc cacttgaagc tatgtatgct       480
     ctagatgcag ctcttaaagc agcagacgta gcaattggaa ctttctacgg accaccatcc       540
     gaaactaact tcggtggagc acttttaaca ggtagtcaat ctgcatgtaa agctgcttgt       600
     gatgcgttca aaatggcagt agaaaatgtg gctgaaaatc cacttcaata ttaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page