(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1142

AL596167.LIN1142     Location/Qualifiers
FT   CDS_pept        194214..194711
FT                   /transl_table=11
FT                   /gene="lin1142"
FT                   /note="similar to putative carboxysome structural protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM9"
FT                   /protein_id="CAC96373.1"
FT                   /translation="MPNEALGLIEVTGFLGAVVAADTCLKAANVELIRCEVIKGGLTTV
FT                   ELTGDVGAVNAAVEAGKAATESLGCLISSHVIARMSEETKSLFVKAEQEIEETKEVIQE
FT                   VVEVKTTTDETEKKLREMKVIDLRKLAYTLDNVPIPKSKIKYANKDKLVHALKDIYGRS
FT                   EN"
     atgccaaatg aagcacttgg tttaattgaa gtcactggtt tccttggtgc tgtggttgcc        60
     gctgatactt gtttaaaagc agcaaatgtt gaattaatta gatgtgaagt cattaaaggt       120
     ggcttaacaa cagttgaatt aacaggcgat gttggtgctg taaatgcagc agtggaagca       180
     ggaaaagcag ctacagaaag cttaggttgc ctcatttcta gtcacgtgat agcaagaatg       240
     agtgaagaaa cgaaatcact ctttgtaaaa gctgagcaag aaatagaaga aacaaaagaa       300
     gttatccaag aagtcgtaga agtaaaaaca actacagatg aaacggaaaa gaaacttcgc       360
     gaaatgaaag ttattgattt aaggaaactt gcttacacat tagataatgt gcctatccca       420
     aaaagcaaga ttaaatatgc gaacaaggat aaacttgttc acgcactaaa agatatttat       480
     ggaaggagtg aaaactag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page