(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1146

AL596167.LIN1146     Location/Qualifiers
FT   CDS_pept        197421..198062
FT                   /transl_table=11
FT                   /gene="lin1146"
FT                   /note="similar to Salmonella enterica PduL protein"
FT                   /db_xref="GOA:Q92CM5"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM5"
FT                   /protein_id="CAC96377.1"
FT                   /translation="MNNELITSLIEEVTRRALLETGVEVEASGRHVHLDRETVDALFGP
FT                   GYELTHFRDLSQPGQYVCKERISIVGPKSVIHNVVILGPIRKKTQVEISATDGTALGIK
FT                   APVRESGDIAGTPGILLLSAKNSVQLTEGLIVAKRHIHMTPEDAAKQQVTQSEIVQVKI
FT                   NGDRPLIFDDVVVRISPDFATYMHIDYDEANACGFKKGIRGQIIKKTKAK"
     atgaataatg agttaataac aagccttatt gaagaagtca ctcgccgtgc attacttgaa        60
     actggcgtag aagtagaagc atccggtcgt cacgtccatt tagatcgtga gacagttgat       120
     gcactttttg gacctgggta tgaacttact catttccgtg acctatctca accaggtcaa       180
     tatgtttgta aagaaagaat tagcattgtt ggaccaaaaa gcgtgattca taacgtagta       240
     attcttggac caatccgtaa aaaaacacaa gtagaaatta gtgctacaga cggtaccgca       300
     cttggtatta aagcacctgt ccgcgaaagt ggagacatag ccgggacacc aggaatttta       360
     cttttatctg ctaaaaacag tgttcaatta actgaaggac ttattgttgc aaaacgccat       420
     attcatatga cgccagaaga tgcagcaaaa caacaagtaa cacaaagtga aattgttcaa       480
     gtgaaaatta atggcgacag accactgatt tttgacgatg tggtcgttcg aattagccct       540
     gattttgcta catatatgca tattgattac gacgaagcca acgcatgcgg ctttaaaaag       600
     ggaattcgag gtcaaataat taagaaaaca aaggcaaaat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page