(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1148

AL596167.LIN1148     Location/Qualifiers
FT   CDS_pept        198646..198915
FT                   /transl_table=11
FT                   /gene="lin1148"
FT                   /note="similar to carbon dioxide concentrating mechanism
FT                   protein"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM3"
FT                   /protein_id="CAC96379.1"
FT                   /translation="MQIGKVTGSLWATRKDEKLNGLKLLLVEICTDEVEDKRHSIVAAD
FT                   NAGAGNGDLVLVTTGSAARASTGDNTIPVDACIVGIIDSVERYG"
     atgcaaattg gaaaagttac cgggagttta tgggcgacaa gaaaagatga aaaactgaat        60
     ggtttaaaac tactactagt agagatttgt accgatgaag tggaagataa aagacattcc       120
     atagtggcag ctgataatgc cggagcagga aacggtgatc tcgtgctcgt tacaactggt       180
     agcgcagcac gagcatctac tggggataat acaataccag tggacgcgtg tatcgtcggc       240
     attatcgact cggtagaacg ttatggctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page