(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1149

AL596167.LIN1149     Location/Qualifiers
FT   CDS_pept        198908..199453
FT                   /transl_table=11
FT                   /gene="lin1149"
FT                   /note="similar to Salmonella enterica PduT protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR013501"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM2"
FT                   /protein_id="CAC96380.1"
FT                   /translation="MAEQSLGILELRSISKGYEMADVFLKAGNVTLFTFRPTCPGKFLI
FT                   ILQGASGELTSAMQDAKEEAGKFHVSSYILHMAHEELLAFLNNKHPKVDVDAVGIIEIS
FT                   QLGAGLNAVNEALKKSAIHLKRMTLGASIGGKFVAVFTGEVSAIQEGMRILIETAEPKK
FT                   VIHHTVIPSPDELLKRYL"
     atggctgaac agtccttagg tattcttgaa ctcaggagca taagtaaagg ttacgaaatg        60
     gccgatgttt ttttaaaagc tggcaatgta actttattta cttttcgtcc gacatgtcct       120
     ggtaaatttt tgattatttt gcaaggtgct tccggtgaac ttactagtgc gatgcaagat       180
     gcaaaagaag aagcagggaa atttcatgtt tcttcttata ttttgcatat ggcgcacgaa       240
     gaattacttg cttttctaaa caataaacac cctaaagttg atgttgatgc agtaggaatt       300
     atcgaaatca gtcaattggg tgctgggcta aacgcggtga atgaagcgct aaaaaaatca       360
     gctattcatt taaaacgaat gacgctcggt gcttcgattg gtgggaaatt tgtggctgtt       420
     tttacagggg aagttagtgc tattcaagaa gggatgcgga ttctaatcga aaccgcagaa       480
     ccaaaaaagg tgatacatca tacggtcatt ccttctcctg atgaactttt aaaacgctat       540
     ctatag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page