(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1150

AL596167.LIN1150     Location/Qualifiers
FT   CDS_pept        199469..200590
FT                   /transl_table=11
FT                   /gene="lin1150"
FT                   /note="similar to ethanolamine utilization protein EutH -
FT                   Escherichia coli"
FT                   /db_xref="GOA:Q92CM1"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM1"
FT                   /protein_id="CAC96381.1"
FT                   /translation="MSINEIIIYLMVIFMILGAIDKIIGNKFGLGAQFEEGIMAMGSLT
FT                   LAMVGIITLAPVLAKILSPIVVPIYTALGADPAMFATTLLANDMGGFALAQELALTPDA
FT                   GLFAGAILGSMMGPTIVFTIPVALGIIKKEDHKYLATGVLSGIITIPIGCLIGGLVAGF
FT                   SPIMIFKNLVPILLVAVLIMLGLWFKPEGMIKGFTIFGKGVVIVATIGLVAGAIQQLTG
FT                   LTIIPGIAPIGEGIEIVGGIALVLAGAFCLVFVITKVFNKPLMKMGKLLGMNEVAAAGM
FT                   VATLANSIPMFQMLKDMDERGKIINVAFAVSAAFVLGDHLGFTAGVAQDMIFPMIVGKL
FT                   VGGVTAVAVAIYMANRMMKKNKAKEQTAVKDNG"
     ttgagcatta atgaaattat tatttattta atggtaatct ttatgattct aggagccatt        60
     gacaaaatta tcggtaacaa atttggctta ggagcacaat ttgaagaagg tattatggca       120
     atgggatcgc taactctagc tatggtcggt attattactt tagcaccagt tttagcgaaa       180
     attttaagcc cgattgttgt accaatttat acagcgcttg gggctgaccc agcaatgttt       240
     gctacaactt tacttgcgaa tgatatgggt ggttttgcgc tagctcaaga acttgcgcta       300
     acgcctgatg ctggtctttt tgcaggagct attttaggct caatgatggg accaacaatt       360
     gttttcacga ttccagtagc acttggaatt attaaaaaag aagaccataa atacctagcg       420
     actggtgtac tatctggtat tattacgatt ccaatcggtt gtttaatcgg tggtcttgta       480
     gctggatttt caccaatcat gattttcaaa aacttagtac caattcttct tgtagctgta       540
     cttattatgt taggtctttg gttcaaacca gaaggcatga ttaaaggctt tacgattttc       600
     ggaaaagggg tagtaattgt tgctactatc ggacttgtgg ctggagctat tcaacaactt       660
     actggtttaa ctattattcc aggaattgca ccaattggcg aaggtatcga aatcgttggt       720
     ggtatcgcac tagttctagc aggagctttc tgtttagttt ttgttattac gaaagtgttc       780
     aacaaaccac ttatgaaaat gggtaaatta cttggtatga atgaagttgc agcggctggt       840
     atggttgcga cacttgcaaa tagtatccca atgttccaaa tgctaaaaga tatggatgag       900
     cgcggtaaaa ttattaacgt tgcttttgca gtatctgcgg cctttgtttt aggggatcat       960
     ctaggtttca cagctggggt tgcccaagat atgattttcc cgatgattgt cggaaaactt      1020
     gtcggaggag taactgcagt agctgtagct atctacatgg ctaaccgaat gatgaagaaa      1080
     aataaagcaa aagaacaaac ggcggtgaaa gataatggct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page