(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1151

AL596167.LIN1151     Location/Qualifiers
FT   CDS_pept        200583..201029
FT                   /transl_table=11
FT                   /gene="lin1151"
FT                   /note="similar to ethanolamine utilization protein EutQ"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM0"
FT                   /protein_id="CAC96382.1"
FT                   /translation="MADISKELIEQLVKQVVLEKMGQSSKHVDPSGILSVKLPEVRVSE
FT                   EDRLDTGNPSDVVYTKDLVTLEESKRLGFGLMEMKDTTFDWFLDYDEVDYIIEGRLDVV
FT                   IDGRNVSAGPGELIFIPKGSQIKFSVTGEARFIYVTYPADWQSQ"
     atggctgata ttagtaaaga attaattgag cagctagtaa aacaagttgt cctagaaaaa        60
     atgggtcaaa gttccaaaca cgttgaccca agtggtattt tatccgttaa acttccagaa       120
     gtaagagttt ctgaagaaga ccgtttagat actggtaacc ctagtgatgt tgtttataca       180
     aaagatttag taacattaga agaaagtaaa cgtctaggtt ttggtctaat ggaaatgaaa       240
     gatacaacat ttgattggtt cttagattac gatgaagtag attatattat tgaaggcaga       300
     ctagatgttg tcatcgatgg tagaaatgtt tctgcaggac caggcgaact gattttcatt       360
     ccaaaaggaa gccaaattaa gttctctgta actggagaag cgagattcat ttatgttact       420
     tatccggctg attggcagtc acaataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page