(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1155

AL596167.LIN1155     Location/Qualifiers
FT   CDS_pept        204118..205065
FT                   /transl_table=11
FT                   /gene="lin1155"
FT                   /note="similar to cobalamine synthesis protein CbiB"
FT                   /db_xref="GOA:Q92CL6"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CL6"
FT                   /protein_id="CAC96386.1"
FT                   /translation="MSVLFYTISFILDFILGDPYSWPHPIKVIGNFIQLLTNALRKIFH
FT                   GKSLYFAGGLLFILTVGMTGIVSWLILYISAKIAFWLYAAVFIYLGYTTLAMTCLAKEA
FT                   RKIQRTLADGDLEAARVQVGMIVGRDTDKLTAEQISKATIETVAENTADGVIAPLFYLF
FT                   IGGPVLALMYKAVNTLDSMVGYKNEKYRAIGFVSAKMDDLANFIPARLSWFFLVIASFI
FT                   LKYDGRTAWRIGLRDRKNHTSPNCAYPEGAVAGALGITLGGTHEYFGETVVKPTIGSGT
FT                   KAVTQKEISQTIHLLYTASIIAFLIFISIHLILF"
     atgagcgtac tcttttatac catatcgttt attttagatt tcatactagg tgacccttac        60
     agctggcctc atcctatcaa ggtaattggt aactttattc aattattaac gaacgctttg       120
     cggaaaattt ttcatggtaa atcactgtat tttgctggag gcctattatt cattcttaca       180
     gttggaatga cgggaattgt ttcgtggctc atcctttata ttagtgcaaa aattgctttt       240
     tggctttatg cggcggtgtt tatttactta gggtatacga cacttgcgat gacttgcctt       300
     gcgaaggagg cgcggaaaat tcagcgaaca ctcgcggatg gtgatttaga agcggctaga       360
     gtacaagttg ggatgatagt tggtcgggat acagacaagc ttacggcaga acaaatcagt       420
     aaagccacca ttgaaaccgt ggcggaaaac acagcagatg gcgttatagc accattattt       480
     tacttattca ttggaggacc tgtgctagcc ttgatgtata aagccgtgaa cacacttgat       540
     tcgatggtcg gttataaaaa tgaaaaatat cgcgccattg gttttgtttc cgcaaaaatg       600
     gatgatttgg ccaatttcat tccagcaagg ctatcttggt ttttccttgt gattgcgagt       660
     tttattttga agtatgatgg acgcactgca tggcggatag ggcttcgtga ccggaaaaat       720
     catacaagtc ccaattgcgc atatccagaa ggcgcggtag caggagcgct tgggataaca       780
     cttggtggca cccatgaata tttcggcgag acagttgtta aaccaaccat cggcagtgga       840
     acaaaagccg ttacacaaaa agaaatcagt caaacaattc acttactata cacagcttcc       900
     attattgctt ttctaatttt tatcagtata catttaatac tattttaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page