(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1163

AL596167.LIN1163     Location/Qualifiers
FT   CDS_pept        210491..211243
FT                   /transl_table=11
FT                   /gene="lin1163"
FT                   /note="similar to cobalamin biosynthesis J protein CbiJ "
FT                   /db_xref="GOA:Q92CK8"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK8"
FT                   /protein_id="CAC96394.1"
FT                   /translation="MIFVLGGTSDSLLISDWLTETKRPFILSVATDYGETLAKQHAEKV
FT                   FCGRLAKEAMLAKWQLEQIKLVIDATHPFATIVSETAMEACKEAGIPYIRFERTSEQTD
FT                   NTYLVDDINEACKVAAKLGQRIFLTTGSKNLPEFVAGLKQQHIIARILPVSDVIRSAEE
FT                   LGLVADQIIGMKGPFTKEANRTQLEMTQADVLITKESGKQGGFQEKLTAAAELNIPVIV
FT                   IRRKKLNYPIEINHLTELPEILTQLEVY"
     atgatttttg tgcttggagg aacttctgat agcttgttaa ttagtgactg gctaacggaa        60
     acaaaacgac catttattct ttcagtagca acagattacg gtgaaacttt agctaagcaa       120
     catgcagaaa aagtattttg cggtcgatta gccaaagaag caatgctcgc aaaatggcag       180
     ttagagcaaa tcaagcttgt tattgatgcc actcatccct ttgcaaccat cgtttctgaa       240
     acggccatgg aagcatgcaa agaagcgggc attccataca tccgctttga gcgaacaagc       300
     gaacaaaccg ataatactta tttagtagat gatattaacg aagcatgtaa agttgctgca       360
     aaacttggtc aacgaatttt tcttacaaca ggtagtaaaa atttacctga atttgtggca       420
     gggctgaaac aacaacatat tatcgctcgt attttgccag tgtctgatgt gattcgttca       480
     gcagaagaac ttgggctcgt tgccgaccaa ataattggca tgaaaggtcc gttcactaaa       540
     gaagccaacc gcacacagct agaaatgaca caagcggacg tattaattac taaagaaagt       600
     ggaaaacaag gcggatttca agaaaaactc acggcagcag cagaattaaa tattcctgtt       660
     atcgttattc gccgaaaaaa attaaattat ccaatcgaaa taaatcattt aaccgaacta       720
     ccagaaattt taactcaatt ggaggtctac taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page