(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1167

AL596167.LIN1167     Location/Qualifiers
FT   CDS_pept        214206..214940
FT                   /transl_table=11
FT                   /gene="lin1167"
FT                   /note="similar to cobalamin biosynthesis protein M "
FT                   /db_xref="GOA:Q92CK4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK4"
FT                   /protein_id="CAC96398.1"
FT                   /translation="MKKLWKFLPFVLIGVIYFTLTNPESAHAMHIMEGFLPVKWAVFWL
FT                   IVFIPFLVLGLIRIRKLIALDKNNKLLLALCAAFIFVLSALKIPSVTGSCSHPTGVGLA
FT                   TVMFGPLVVSVLGVIVLLFQALLLAHGGITTLGANAMSMAVIGPMVGFVVYKLARKLNC
FT                   NKSVSIFLCAMTADLATYLTTSVQLGVVFPDPASGMMASILKFMAIFCVTQVPIAIAEG
FT                   LLTVVMYNLISKNLPEKVAQLR"
     atgaaaaaat tatggaagtt tctaccattt gttttaatcg gcgttattta ttttacttta        60
     acgaacccag aatccgcaca tgcaatgcat atcatggagg gctttttacc cgttaaatgg       120
     gcagtctttt ggctaattgt ctttatccca ttccttgtac ttggtttaat tcgtattcgt       180
     aaattaatcg ctttagataa aaataataaa ttactgttgg cattatgtgc agcctttatc       240
     tttgttcttt ctgcacttaa aatcccgtcc gttacaggat cttgttctca tccgacaggt       300
     gttggacttg caacggttat gttcggaccg ctcgttgtca gtgttcttgg cgtgattgtc       360
     ttacttttcc aagcgctact tcttgcacac ggcggtatta ctactcttgg tgcaaacgca       420
     atgtcgatgg ctgttatcgg tccaatggtt ggttttgtcg tctataaact agctcgtaaa       480
     ctaaactgta ataaaagtgt ttcgattttc ttatgtgcaa tgacagctga cctggcaacc       540
     tacttaacca ccagcgtcca gctcggagtc gttttcccag atccagcatc aggcatgatg       600
     gcttctattc taaaattcat ggcaattttc tgtgtcactc aagttccaat cgcgattgca       660
     gaaggcttac tcactgtagt tatgtacaat cttattagca aaaatttacc agaaaaggtg       720
     gcacaattac gatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page