(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1168

AL596167.LIN1168     Location/Qualifiers
FT   CDS_pept        214937..215233
FT                   /transl_table=11
FT                   /gene="lin1168"
FT                   /note="similar to putative cobalt transport protein CbiN"
FT                   /db_xref="GOA:Q92CK3"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK3"
FT                   /protein_id="CAC96399.1"
FT                   /translation="MKKININIILILLVVLLMVSPFFFNKTGEYGGSDGEAEAEITKID
FT                   PSYEPWFEPLYEPKSGEIESLLFTLQGCIGTGIIAYVIGVSRGKRKAENDVNH"
     atgaaaaaaa tcaatattaa tatcatttta attttattag tagttttgtt aatggtgagc        60
     ccgtttttct tcaataaaac aggtgagtac gggggatcag acggagaagc tgaagcagaa       120
     atcactaaaa tcgatccaag ctatgaaccg tggtttgaac ctctttatga accaaaaagt       180
     ggcgaaattg aaagcttatt atttaccctg caaggttgca tcggaacagg aatcattgcg       240
     tatgtcattg gtgtaagtcg tggcaagcgg aaagctgaga acgatgttaa ccattga          297
//

If you have problems or comments...

PBIL Back to PBIL home page