(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1170

AL596167.LIN1170     Location/Qualifiers
FT   CDS_pept        215910..216716
FT                   /transl_table=11
FT                   /gene="lin1170"
FT                   /note="similar to cobalt transport ATP-binding protein
FT                   CbiO"
FT                   /db_xref="GOA:Q92CK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CK1"
FT                   /protein_id="CAC96401.1"
FT                   /translation="MLKTEHISFQYEDGKQALTDVSIDLDKGNIIGLIGANGSGKSTLF
FT                   MQLLGINRPTSGTVYFEGKPLAYNKKALFALRKKVSIVFQDPDQQIFYSNVRDDVAFAL
FT                   RNLGISEKEVESRVTNVLETVGATEFQHKPVQYLSYGQKKRVAIAGALVLDTDWLLLDE
FT                   PTAGLDPIGKKIMMEIIERLAKQGKKILISSHDIDLIYEICDYVYMLKDGTVLTSGETS
FT                   EVFLEKSHIEQAGLVQPWLIKLHQQAGYPLFKKEADFFAHTGKVIN"
     ttgcttaaaa cagaacatat ttcattccaa tacgaagatg gcaaacaagc cttaacggat        60
     gtttcaatcg atttagataa aggcaatatt attggcctta ttggtgcgaa tggctccggg       120
     aaatcgaccc tttttatgca gcttttaggc attaataggc caacttcagg gacagtttat       180
     tttgaaggaa aaccacttgc ttacaataaa aaagccttat ttgcattgcg aaaaaaagta       240
     agtattgttt tccaagaccc cgaccaacaa attttctatt ccaatgtacg tgatgacgtg       300
     gcttttgcac ttagaaacct aggtattagt gaaaaggaag tggagtcacg agtaacaaat       360
     gtactagaaa cagttggtgc gacagaattt caacataaac ctgtccaata cttaagttat       420
     ggtcaaaaaa aacgtgtcgc tattgccgga gcgcttgttc ttgatacaga ttggttgctg       480
     cttgatgaac caactgcagg acttgatccg attggtaaaa aaattatgat ggaaattatc       540
     gaacgtcttg caaaacaagg aaaaaagatt ctcatttcaa gtcatgacat cgatttgatt       600
     tatgagattt gcgattatgt ctatatgtta aaagacggaa cagttttaac aagcggggag       660
     acgagcgagg ttttcttaga gaaaagtcat atcgaacaag cagggttagt acagccgtgg       720
     ctaatcaaat tacaccaaca agctggctac ccacttttca aaaaagaagc cgattttttc       780
     gcacatacgg ggaaggtgat taattaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page