(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1172

AL596167.LIN1172     Location/Qualifiers
FT   CDS_pept        218215..218781
FT                   /transl_table=11
FT                   /gene="lin1172"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q92CJ9"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ9"
FT                   /protein_id="CAC96403.1"
FT                   /translation="MRIYTKTGDKGMTRIIGGSKVSKDNIRINAYGTLDELNSLIGYTI
FT                   TTLGNEPEIQAELEQIQQQLFDAGGDLATEEGKRDYKLTAEPVAWLEDRIDIYADEPPE
FT                   IEKFILPGGTQAASLLHMARTVARRAEREIVGMLKIASTNQEVLKYVNRLSDYFFAVAR
FT                   VVNYRAGETDIFYKNSELVFRNKKK"
     atgcgtatct acacaaaaac cggcgataaa ggaatgacaa gaattatcgg ggggagcaaa        60
     gtaagtaaag ataatatacg aattaatgca tatggtacac tcgacgaact caattcgctt       120
     atcggttaca ccattacaac tcttggaaat gaacccgaaa ttcaagctga acttgagcaa       180
     atccaacaac aattattcga tgcaggaggc gacctcgcaa cagaagaagg gaagcgcgat       240
     tataaactga cagctgagcc agttgcttgg ctagaagacc gcattgatat ttatgccgat       300
     gaaccacctg aaattgaaaa attcattttg ccaggaggta ctcaagcagc ttctttactt       360
     catatggcta gaacagtggc aaggagagca gaacgagaaa ttgttggtat gctaaaaatc       420
     gcctccacta accaagaagt attaaaatat gtaaatcgct tatctgatta ctttttcgct       480
     gttgccagag tcgtgaatta tcgcgcaggc gaaaccgata ttttctacaa aaattccgaa       540
     ttagtttttc gaaataaaaa gaaataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page