(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1176

AL596167.LIN1176     Location/Qualifiers
FT   CDS_pept        220406..220717
FT                   /transl_table=11
FT                   /gene="lin1176"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ5"
FT                   /protein_id="CAC96407.1"
FT                   /translation="MDEKLRKTYLPMTETAFYILLSLVKPKHGYAIIENVAQMTNERIK
FT                   LGPGTIYGSLSKMNKDNLIQIIQEESNRKIYQITEIGAEVLQLEKTRIEELYRNSREV"
     atggatgaaa aactacgaaa aacctatctt cccatgactg aaactgcctt ttacatatta        60
     ctttcgctag ttaaaccgaa gcacggttac gcgataattg aaaatgttgc ccaaatgacc       120
     aatgagcgga ttaaacttgg accaggaact atttacggta gtttatccaa aatgaacaaa       180
     gacaatttaa tccaaatcat ccaagaggag agcaaccgaa aaatctatca aatcacagaa       240
     atcggtgccg aggttttgca gttagaaaaa acacgcatag aagaattgta tagaaattcg       300
     agggaggttt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page