(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1183

AL596167.LIN1183     Location/Qualifiers
FT   CDS_pept        226255..226578
FT                   /transl_table=11
FT                   /gene="lin1183"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP07"
FT                   /protein_id="CAC96414.1"
FT                   /translation="MTDAHTVCPKFESAFQLLGKRWTGLIINVLLTGPKRFKQVAAEIP
FT                   QMSDRVLAERLKELEEMDICLRQVYPETPVRIEYELTEKGKALQEVMLEVQCWADKWVE
FT                   VPN"
     atgactgatg cacatacagt atgtccgaag tttgaatcgg cgttccaact attaggtaaa        60
     cgctggactg gacttatcat caatgtctta ctgactggtc caaaaaggtt taaacaagtt       120
     gccgctgaga tcccacaaat gagtgatcgg gtgcttgcag aacgtttgaa ggaacttgag       180
     gaaatggata tttgcttaag acaagtttat ccagaaactc ctgtacgcat tgaatatgaa       240
     ctaaccgaaa aaggtaaagc actccaagaa gtaatgcttg aagtccagtg ttgggcggat       300
     aaatgggtgg aagtacctaa ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page