(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1189

AL596167.LIN1189     Location/Qualifiers
FT   CDS_pept        235249..238449
FT                   /transl_table=11
FT                   /gene="lin1189"
FT                   /note="similar to transporter, (to B. subtilis YdgH
FT                   protein)"
FT                   /db_xref="GOA:Q92CI2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CI2"
FT                   /protein_id="CAC96420.1"
FT                   /translation="MKWIMKLRWAILAFWLAAAVVLMFIAPPMADLVREKGELKLPDGY
FT                   PSSLATEMQKKHNPDDKGSAYIAVYTADHKLTGTELNNIKKSLDSIDKNKDELHVTNVV
FT                   SSFNQPELKDKFLSKDGKTMVASLTVDDTDASVKSIRNALDKKMDVKGVDTYLTGNKLI
FT                   QEDVVQGSEDGLHKTEGITVVFILVVLFLVFRSAVAPFIPLLTVGISYLVAQSTVAFLI
FT                   DIFNFPVSTYTQIFMVCIMFGIGTDYCILLMSRFKEEMGAGLDPRESVHATYRTAGKTV
FT                   IYSGVAVLVAFTSLYFVQFDLYRSAVAVGVGIVVLLAALYTLVPFFMSTLGTHLFWPLN
FT                   KNISHKENKVWGAAGKFTFARPWIALLIVAAITLPPILLHTGTESFNSLDEISDKYPSK
FT                   KGFEIVSDSFGAGQVAPTQVFIENDDNMRTTEYIAQIEKISDDLSHLKGIDMVMSASRP
FT                   AGKRVDDIYIKNQAGQVNDGVGQATDGVGEVKKGLDSASSELKKSEPALDKAVAGVGDL
FT                   QKGTVATEQGINQLQAALAQIQIGIESGATGAGDLKQGVAEAKSQLASLQNGEAQIQAG
FT                   YAEIQKNLQNVAEQLKGFGNPNSPAIDTSKLEAQFKKIGESFQTFAAAHPEVRNDPKFQ
FT                   KLAADIQGLQTAGNELKTTAGQQMAALQAKMKELNQGIQQLATAMNQLNEQSKQISDGL
FT                   SAFGTGLGQIETGLDQLENGLNQAADGQGQVVSKMPEISNALSQIAAGQGALKEGFAGI
FT                   SGQMGELTNGLTSGADGLGKVESGLNTANGLIDDWSKVPYASSGIYVPDALLKNADFQK
FT                   VLDQYISSDGKLATINVILTKNPYSNGAMDSIDDINEQLAASMKGTKLENAKIGIGGMT
FT                   SANYDTRDMSTADYHLVLVIVLASVFVTLVIVLRSLVMPIYLIASLVLTYFAALGFAEI
FT                   IFMRILGYSGLTWATPFFGFVVLVALGIDYSIFLMSRFNEYNGLSVRDRMIKAMKNMGG
FT                   VIFSAVIILGGTFAAMMPAGVLSLLEIATVVLIGLVLYAIVILPLFVPVMVKLFGRGNW
FT                   WPFITRKGDHQENVPPKK"
     atgaaatgga ttatgaaact ccgctgggcc attttagcat tttggcttgc agcagcagtc        60
     gtactaatgt ttatcgcacc acccatggca gatcttgtac gcgaaaaagg cgaattaaag       120
     ctgcctgatg gttatccgtc ctcacttgcg acagaaatgc aaaagaaaca caatccggat       180
     gacaaaggtt cagcatacat tgcggtgtac acagctgacc ataagttaac tggaactgag       240
     ttaaacaata ttaaaaaatc acttgattcc attgacaaaa ataaagatga acttcacgta       300
     accaacgttg tatcaagttt taatcaaccc gaattaaagg ataaattctt atcaaaagac       360
     ggtaaaacga tggtagcaag tctaactgta gatgacacag atgcctctgt taaaagcatt       420
     cgaaacgctt tagacaaaaa aatggatgtt aaaggcgttg atacttactt aacaggaaat       480
     aaattaattc aagaggatgt tgttcagggt tcagaagacg gtttacataa gacagaaggc       540
     atcacagttg tctttatttt agtcgtatta ttccttgtat ttagatctgc agtagcgccg       600
     ttcattccac ttttaactgt aggaataagt tatctcgttg cacaaagcac ggtcgctttc       660
     ttaattgaca tctttaattt tcctgtttcg acctatacgc aaatatttat ggtgtgtatt       720
     atgtttggga ttgggacgga ctattgtatt ctcttaatga gtaggtttaa agaagaaatg       780
     ggagcagggc tagatccacg agaatctgtt catgcaactt atcgtacagc gggtaaaaca       840
     gttatttata gtggtgtagc tgtactcgtt gccttcactt cgctttattt cgttcaattt       900
     gatttatatc gttccgcagt cgctgttggt gtcggtattg tcgtcttact cgcagcactt       960
     tatacactcg taccattctt tatgagtacg ctcggaaccc atttattctg gccattaaat      1020
     aaaaatatta gccacaaaga aaataaagtg tggggagctg ctgggaaatt cacatttgcg      1080
     agaccatgga ttgctttact catcgttgca gctatcacat tgccgccaat tttactgcat      1140
     acaggaacag aatcatttaa ctcattagat gaaattagtg acaaatatcc ttctaaaaaa      1200
     ggatttgaaa tcgtttcaga tagttttgga gcaggacaag tcgcgcctac acaagttttt      1260
     atcgaaaatg acgataacat gcgtacaaca gaatacattg cgcaaatcga aaaaatttcc      1320
     gatgatttat ctcacttaaa aggtattgat atggttatga gcgcgtcacg tccagcagga      1380
     aaacgtgtcg atgatattta cattaaaaat caagctggac aagtaaatga cggcgttgga      1440
     caagcaactg acggagtagg tgaagtcaaa aaaggcttag attctgctag ctcagaactt      1500
     aaaaaatcag aaccagctct tgataaagca gttgctggag ttggcgacct tcaaaaaggt      1560
     accgtggcaa ccgagcaagg catcaatcaa cttcaagctg cactcgcaca aattcaaatt      1620
     ggaattgaaa gtggcgcaac cggtgcagga gacttaaaac aaggagtagc agaagccaag      1680
     tcacaactcg cttcacttca aaatggagaa gcacaaattc aagcaggtta tgcagaaatt      1740
     cagaaaaact tgcaaaatgt agcagaacaa ttaaaaggct ttggaaatcc caattcacca      1800
     gcaattgaca catccaagct cgaagcacag tttaagaaaa tcggggaatc gttccaaaca      1860
     ttcgcagcag cacatccaga agtaagaaac gatcctaaat tccaaaaact agcggctgat      1920
     atacaaggtc tacaaacagc tggtaatgaa ttaaaaacaa ctgcaggaca acaaatggcc      1980
     gctcttcaag caaaaatgaa agaactaaat caaggtattc aacaattagc aaccgcaatg      2040
     aaccaattaa atgaacagtc caaacaaatt tcagacggcc taagcgcatt tggcactgga      2100
     cttggtcaga ttgaaactgg actcgatcaa ttagaaaacg gtctaaatca agccgcagac      2160
     ggtcaaggtc aagtcgtttc taaaatgcct gaaatctcta acgccctatc tcaaattgca      2220
     gcaggacaag gtgcactaaa agaaggtttt gccggaatta gtggacaaat gggtgaacta      2280
     acaaatggct taacttcagg agctgatgga ttaggcaaag tagaaagtgg tctaaacaca      2340
     gcgaacggac ttattgatga ttggtcgaaa gttccttacg caagttctgg aatttacgta      2400
     ccagatgcgc tattaaaaaa tgctgatttc caaaaagtac tagaccaata catttcttct      2460
     gatggaaaac tagctacgat taatgttatt ttgacaaaaa atccatattc gaatggagca      2520
     atggattcca tagatgacat taatgaacaa ctcgcagcta gtatgaaagg cacaaaacta      2580
     gaaaatgcca aaattggtat tggcggaatg actagcgcta actatgatac aagagatatg      2640
     tcaacagccg attatcattt agtacttgtt atcgttctag ctagtgtatt cgtaaccctt      2700
     gttatcgttt tacgttcact tgtaatgcca atttacctta tcgcatcact tgtattaact      2760
     tactttgcgg cacttggatt tgcagaaata atctttatgc gaattctcgg ctatagtgga      2820
     ctaacatggg caaccccatt cttcggattt gttgtactcg tcgcactcgg tatcgattat      2880
     tcgatattcc ttatgtcacg atttaatgaa tataatgggc tttccgttcg tgatagaatg      2940
     ataaaagcga tgaaaaatat gggcggcgtt atcttcagcg cagtgatcat tctcggtgga      3000
     acattcgccg cgatgatgcc agcaggagtt ctttccttac ttgaaatcgc aacagtagtt      3060
     ctgattggct tagtgctcta cgccatcgtt atcttaccac tattcgtacc agttatggtt      3120
     aaactattcg gtcgtggtaa ttggtggcca tttatcacaa gaaaaggcga tcatcaagaa      3180
     aacgtaccac cgaaaaaata a                                                3201
//

If you have problems or comments...

PBIL Back to PBIL home page