(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1192

AL596167.LIN1192     Location/Qualifiers
FT   CDS_pept        240347..240610
FT                   /transl_table=11
FT                   /gene="lin1192"
FT                   /note="similar to B. subtilis YshA protein"
FT                   /db_xref="GOA:Q92CH9"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH9"
FT                   /protein_id="CAC96423.1"
FT                   /translation="MANERNKVVTTIYGREYTIVGVETADHLRKVARQVDEKMHEIGSQ
FT                   NHALDSGRLAVLTAVNATHDYLKLEQKYLELEQELARIKGRD"
     gtggcaaatg agagaaataa agtagtgaca acaatttatg gtagagaata tacgattgtt        60
     ggcgtagaaa cagctgacca cttacgaaaa gtagctcgtc aagttgatga aaaaatgcac       120
     gaaattggct cccaaaatca tgcgctagat agtggtaggc tcgcggtatt aacagctgtg       180
     aatgcaactc acgattattt aaaactagaa caaaaatatc tagagttgga acaagaactg       240
     gctcgaatta aaggaagaga ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page