(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1193

AL596167.LIN1193     Location/Qualifiers
FT   CDS_pept        240610..241152
FT                   /transl_table=11
FT                   /gene="lin1193"
FT                   /note="similar to B. subtilis YshB protein"
FT                   /db_xref="GOA:Q92CH8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH8"
FT                   /protein_id="CAC96424.1"
FT                   /translation="MILNAIILILLVCGFFAGFRTGLIKQLILLLGYILAFFISYTYYE
FT                   DLAPHLTFIPYPGSDTSDGLSIILQELRTETAYYNVLGFAIIFIVAIIVVHMLASLVGG
FT                   LTKIPVLRQINGLLAAVFGVIKSYLIIFIVLFVMAIYPANWSENLIDSSTVAQWMLENT
FT                   PILSEQFYDWMTDILPK"
     atgattttaa atgcgattat tttaatttta cttgtttgcg gctttttcgc aggatttaga        60
     acaggcctaa tcaaacaact tattttatta cttggttata ttttggcatt ttttatctcg       120
     tatacgtatt acgaagattt agcgccacat ttaactttta taccttatcc aggtagtgat       180
     acttcagatg gattatccat tattttacaa gaattaagaa cagaaacagc ttattacaat       240
     gtacttggct ttgcgattat tttcattgtg gcaatcattg ttgtgcatat gctcgcttcc       300
     cttgttggtg gcttgactaa aatcccagtg ttgcgtcaaa tcaatggatt attagcagct       360
     gtttttggtg ttattaagtc ttatttaatt atttttattg ttttgttcgt catggcaatt       420
     tatccggcaa attggtctga aaacctcatt gatagctcga cggttgctca gtggatgctt       480
     gaaaatacgc caattttgtc cgaacaattt tatgactgga tgacagatat tctgccaaaa       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page