(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1194

AL596167.LIN1194     Location/Qualifiers
FT   CDS_pept        241245..242957
FT                   /transl_table=11
FT                   /gene="lin1194"
FT                   /note="similar to DNA polymerase beta, to B. subtilis YshC
FT                   protein"
FT                   /db_xref="GOA:Q92CH7"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH7"
FT                   /protein_id="CAC96425.1"
FT                   /translation="MATNKKEIIRLLEEIATYMELKGENSFKISAFRKAAQAIELDSRS
FT                   LAEIEDFTKISGIGKTTGEIIQRYLDSGECPELVELKKEVPAGLVPLLDVPGLGGKKLS
FT                   RLYHELGVVDKDTLLKEARNGHIEALKGFGKKSAEKMAEAVREMGERPDRYPLNDVLPI
FT                   IQKVEDYLASIDTIATFARAGSLRRLRETVKDLDYVIATEKPEDVQKALLEFPLITDVI
FT                   GAGETKVSAVLEDNITISVDFRLVEKKAFATTLHHFTGSKDHNIKMRQLAKQSNEKISE
FT                   YGVEQEDGSMRHFESEETFFKHFHIPFLPPEVRRDGTEIERVTKDTKFLELSDIRGDLH
FT                   MHTTWSDGAYAIPEMIEACIAKGYEYMVITDHGKFLRVANGLDEKRLLEQQAEIKKVAA
FT                   NYPEIDVYSGVEMDILADGSLDFDDDTLKQLDFVIASIHSSFQQSEEEIMKRLKTACEN
FT                   PYVRLIAHPTGRIVVKRKPYHVNMKELIKLAKNTGTALELNANPQRLDLNREHLEMAHA
FT                   AGVPIAINTDAHDTKHLDFMSIGVRAATKAWLDKSAILNTKSAAEFKQFLQNK"
     atggctacga ataaaaaaga aatcattcgt ttacttgagg aaatcgccac ttatatggaa        60
     ttaaaaggag aaaatagctt taaaatatcg gctttccgaa aagccgcgca agcaattgaa       120
     ctagatagca gaagtctggc ggaaattgaa gactttacta agattagcgg tattggaaaa       180
     acgacgggtg agattattca acgctatttg gacagcggcg aatgcccaga actcgtggaa       240
     ctaaaaaaag aagtgccagc tggcctcgtt ccacttttag atgtaccagg gcttggtggt       300
     aaaaaattat cacgtcttta ccatgaatta ggcgtagtag ataaagatac attacttaaa       360
     gaagctcgga acggtcacat tgaagcatta aaaggtttcg gtaaaaagtc tgcggaaaaa       420
     atggcagaag cagtgcgcga aatgggcgaa cgacctgata gatacccact aaatgatgtg       480
     ttaccaatca ttcaaaaagt agaagattat cttgctagca tagacacaat tgcaaccttt       540
     gctcgagcag gcagtttacg tagattacga gaaacagtca aagatttgga ttacgttatt       600
     gctactgaaa aaccagaaga cgttcaaaaa gcattactag aatttcctct gattacagat       660
     gttattgggg caggggaaac caaagtatca gctgttctag aagataacat tacaatttca       720
     gtagattttc gcttagtaga aaagaaagct tttgcaacaa ctttgcacca ttttactggt       780
     tccaaagatc ataatatcaa aatgcgccaa ttagctaaac aatcgaacga aaaaatcagt       840
     gaatatggtg tggagcaaga agatggaagt atgcgtcact ttgaatcaga agaaacgttc       900
     tttaaacact ttcatattcc atttttacct ccagaagtac ggcgcgacgg tacagaaatt       960
     gaacgggtga caaaagatac gaaattcctc gagttaagtg atattcgcgg tgatttacac      1020
     atgcatacaa cttggtcgga tggagcttac gcgattcctg agatgattga agcttgtatc      1080
     gctaaaggtt atgagtacat ggtaattacc gatcacggaa aatttttacg agtagccaat      1140
     ggtctggatg agaagagatt acttgagcaa caggcagaaa ttaaaaaagt agctgctaat      1200
     tatccagaaa ttgacgttta ttctggcgtt gaaatggata ttttagcaga tggctctctg      1260
     gactttgatg atgacacttt aaaacagtta gatttcgtta tcgcatcgat tcattccagt      1320
     ttccaacaat cagaagaaga gattatgaaa cgactaaaaa cagcctgtga aaatccatat      1380
     gtgcgtctga ttgctcatcc aacaggtaga attgtcgtga aaagaaaacc atatcatgtt      1440
     aatatgaaag aactaatcaa actagcaaaa aatacaggta ctgcgctaga attaaatgct      1500
     aatccacagc gccttgattt aaatcgggag catttagaaa tggcccatgc agcaggcgtg      1560
     cctatcgcaa ttaatacgga tgcgcacgat acgaaacatc ttgattttat gtcgatcgga      1620
     gtccgtgctg caacgaaagc ttggctagat aaatctgcaa tcttgaatac aaaatcagcc      1680
     gcagaattca aacaattttt acagaataaa taa                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page