(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1195

AL596167.LIN1195     Location/Qualifiers
FT   CDS_pept        242980..245337
FT                   /transl_table=11
FT                   /gene="lin1195"
FT                   /note="similar to MutS protein (MutS2)"
FT                   /db_xref="GOA:Q92CH6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH6"
FT                   /protein_id="CAC96426.1"
FT                   /translation="MEKKVEAILEFDKIKKQLAEFASSSLGEQAIYELAPATDFQVVQK
FT                   AQLETEEGAKIIRLRGSAPITGLTDVFAHLKRLEIGGDLNGLEIYQIGSNLRVSRQMKN
FT                   FMNDLLEIGVEIPLLGALSDELLVLKDVEEDIAISIDESGKILDTASEALSSIRRTLRR
FT                   TEDRVREKLESYLRDRNASKMLSDAVITIRNDRYVIPVKQEYKGHYGGIVHDQSASGQT
FT                   LFIEPQSVVDLNNERKALQAKEKQEIERILAEISASLAGWINEIHHNTFILGRFDFILA
FT                   KARFGKALKAVTPHLSDTGIVHLIAARHPLLDAEKVVANDIYLGEDFSTIVITGPNTGG
FT                   KTITLKTLGLLTLMAQSGLQIPAQEDSTIAVFENVFADIGDEQSIEQSLSTFSSHMTNI
FT                   VSILEKVNHKSLILYDELGAGTDPQEGAALAIAILDASHKKGASVVATTHYPELKAYGY
FT                   NRAHATNASVEFNVETLSPTYKLLIGVPGRSNAFDISRRLGLSESIITEARSLVDTESA
FT                   DLNDMISSLEEKRNLAEREYEEARELARGADALLKDLQKEITNYYQQKDKLLEQANEKA
FT                   AGIVEKAETEAEEIIHELRTMQLNGAAGIKEHELIDAKTRLGKAKPKTINKAIPKAPKQ
FT                   KPHVFQAGDNVRVLSLGQKGTLLNKISDKEWNVQIGIIKMKIKTTDLEYIEPEKPKKQR
FT                   IITSVHSSDSPAKSELDLRGERYEDAIQKVDKYLDEALLAGYPQVAIIHGKGTGALRTG
FT                   VTEYLKNHRMVKSIRFGAAAEGGNGVTIVEFK"
     atggaaaaaa aagtagaagc cattttagaa tttgataaaa taaaaaaaca acttgctgaa        60
     tttgcttctt cctcactagg ggagcaagcg atttatgaac ttgctccagc tacagatttt       120
     caagtcgtac aaaaagcgca acttgaaaca gaagaaggag ccaaaattat tcgtttgcgg       180
     ggaagcgcgc caattactgg tctaacagat gtttttgcac atttgaaacg tctagagatt       240
     ggtggcgatt taaacgggct agaaatctac caaattggta gtaacttgcg tgtaagccgc       300
     caaatgaaaa actttatgaa cgatttacta gaaattgggg tcgaaatacc attactcggc       360
     gcactttctg atgaactttt agtattaaaa gatgtagaag aagatattgc catttcaata       420
     gatgaaagcg ggaaaatatt agatacagca agtgaagcgc ttagctcgat tcgtcgtact       480
     ttgcgacgga cagaagaccg cgtgcgtgaa aagctagaat cttatttacg tgatcgcaac       540
     gcttcaaaaa tgctaagtga tgcggttatt acgattcgaa atgatcgcta tgttatcccc       600
     gtgaaacaag aatataaagg acattacggc ggcatcgttc atgaccagtc tgcatccggt       660
     caaacgctct tcattgagcc acaaagcgtg gttgatttaa ataacgaacg caaagccctt       720
     caagcgaaag aaaaacaaga aatcgaacga atcctagctg aaatttctgc ttcattagct       780
     ggctggatta atgagattca tcataatacc tttattctgg gtcgttttga tttcattctc       840
     gcaaaagctc gatttgggaa agctctgaaa gccgtaacgc cacatttgag cgatactgga       900
     atcgttcatt taatagcagc cagacacccg cttttagatg cagagaaagt tgttgctaac       960
     gatatttatt taggcgaaga ttttagtacg attgttatta ctggtccaaa tacaggtggt      1020
     aaaacaatta cattaaaaac attaggctta ctaaccttga tggcgcaatc aggcttacaa      1080
     atcccagcgc aagaagattc gactatcgct gtttttgaaa acgtatttgc tgatattggc      1140
     gatgaacaat ccattgaaca aagcttaagt actttctcat cccatatgac aaacattgtt      1200
     tccattttag aaaaagtaaa tcataaatca cttattttat atgatgagct cggggctggg      1260
     acggatccgc aagaaggagc agcactagcc attgccattc ttgatgcaag tcacaaaaaa      1320
     ggtgcaagtg ttgttgcaac gacacactat cctgaattaa aagcttatgg atataaccga      1380
     gcacatgcaa ccaatgcttc cgttgaattt aatgttgaaa cacttagtcc aacgtacaaa      1440
     ctactcattg gcgtacccgg acgaagcaat gcatttgata tttcacgccg ccttggttta      1500
     agtgaaagta tcatcacaga agcaagaagc ctcgttgata ctgaaagtgc agacttaaat      1560
     gacatgattt caagtctaga agaaaaacga aatctagcag aaagagaata tgaagaagcg      1620
     cgcgaactag ctcgtggtgc cgatgctctt ttaaaagatt tacaaaaaga aatcacgaat      1680
     tactatcaac aaaaagataa attactcgaa caagcaaacg aaaaagctgc tggaatcgta      1740
     gaaaaagccg aaacagaagc cgaagaaatt atccacgaac tgcgcacaat gcaattaaac      1800
     ggggcagcgg gaatcaaaga acatgaacta atcgatgcta aaacaagact tggaaaagct      1860
     aagccaaaaa caattaacaa agctattcca aaagcaccaa aacaaaaacc acacgttttc      1920
     caagcaggtg acaatgttcg cgtcctatct cttggccaaa aaggtacact tttaaacaaa      1980
     attagtgata aagaatggaa cgtccaaatc ggcatcatca aaatgaaaat caaaacgacc      2040
     gatttagaat atatcgagcc agaaaaaccg aaaaaacaac gcattatcac atctgttcat      2100
     agtagtgact caccagcaaa aagcgagctt gatctacgcg gcgaacgcta cgaagacgct      2160
     attcaaaaag tggataaata cctcgatgaa gcattgctcg caggataccc gcaagtagca      2220
     attattcatg gtaaaggtac tggcgcgctt agaacaggcg tcacggaata tttgaagaat      2280
     catcgtatgg ttaaatccat ccgtttcgga gccgcagcag aaggcgggaa cggcgtaaca      2340
     atcgttgagt tcaagtaa                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page