(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1198

AL596167.LIN1198     Location/Qualifiers
FT   CDS_pept        247799..249013
FT                   /transl_table=11
FT                   /gene="lin1198"
FT                   /note="similar to aspartokinase II alpha subunit"
FT                   /db_xref="GOA:Q92CH4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH4"
FT                   /protein_id="CAC96429.1"
FT                   /translation="MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGK
FT                   STDKLVAMAEEISEAPDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIET
FT                   EAVHSNARIADIDSARIESALEAGQIVIVAGFQGITTDGEITTLGRGGSDTTAVAIASA
FT                   LKAEKCAICTDVVGVFTTDPRYVKKAQKLEQLTYDEMLELANLGAGVLHPRSVEYAKNF
FT                   RIPLEVRASHELEPGTMIEEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFT
FT                   KLAENNIDVDIIIQGITGLGHGNLSFTIKTSELLATLAVLEESKELLQIEKLESEQELA
FT                   KVSIVGSGMVSNPGVAAKMFEALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQ
FT                   FELDK"
     ttgggactag tagtattaaa atttggcgga acctctgtta gcaccgtaga taaaatcgga        60
     aaaacagcag atcaagccat ttacgagaaa aaacaaggga ataaagtcat tgtcgtcgtt       120
     tccgcgatgg gtaaatcaac cgacaaatta gtagcgatgg cagaagaaat cagtgaagct       180
     ccagacaagc gagaaatgga tatgttactt tcaaccggcg aacaaatcac gattgcttta       240
     cttgcgatga ctttaaaaga aaaaggacat gatgctattt cttatacagg atggcaagca       300
     ggaattgaaa cagaagcagt acatagtaac gcaagaattg ctgatattga tagcgcgcgc       360
     attgagtcag cacttgaagc tgggcaaatt gttattgttg cagggttcca aggtataact       420
     acagacggcg aaattactac actcggcagg ggtggctctg atacgaccgc agtagcaatc       480
     gcatccgctt taaaagcaga aaaatgtgct atttgtacag atgttgtcgg cgtattcaca       540
     acagatcccc gttacgtaaa aaaagcccaa aaactagaac aactaaccta tgatgaaatg       600
     ctagaattag ccaatctcgg tgctggagtt ttacatccac gctccgttga atatgcgaaa       660
     aatttccgaa ttccgcttga agtaagagcg agtcatgaac tagaaccagg tacaatgatt       720
     gaggaggatt taacaatgga aaataccaaa gtagtccgcg gaattgcttt tgaagatcaa       780
     attactcgtg taaccattca ctggaaacaa aaagaagcga tgcgcgtttc aaaagttttt       840
     actaaactag cagaaaataa cattgatgta gatattatca ttcaaggtat cacaggtctt       900
     ggtcacggca acttatcctt caccattaaa acaagcgaac tattagctac tctagctgtt       960
     ttagaagaaa gtaaagaact acttcaaatc gaaaaactag aatccgagca ggaactagcg      1020
     aaagtatcca ttgttggttc tggcatggta agtaaccctg gagtcgctgc aaaaatgttt      1080
     gaagctttaa ctgaaaataa tatcccaata aaaatgataa gcacttcaga aatcaaagtt      1140
     tcgacggttg ttcctgcccg taaaatggta gaagcagcac aagttttaca tgaccaattt      1200
     gaattagata aataa                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page