(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1199

AL596167.LIN1199     Location/Qualifiers
FT   CDS_pept        complement(249085..249570)
FT                   /transl_table=11
FT                   /gene="lin1199"
FT                   /note="similar to B. subtilis YslB protein"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH3"
FT                   /protein_id="CAC96430.1"
FT                   /translation="MVYESEVSEMTENEQNNYEEKALVPSFGLDVLRDYLIPEILGDEA
FT                   PHIMYWAGKDLARKFPLESMEEIREFFEEASFGTLSILKEKKDELRLLLEGDMVVSRFR
FT                   TQENPTFKLEAGFIAEQLQTQKKLYTESYDEIDKRKKQVTIIVKWDRKETIDNEERY"
     atggtgtatg aaagtgaggt atccgaaatg acagaaaatg aacagaataa ttacgaggaa        60
     aaagcactcg ttccaagttt tggattagat gtactgcgag attatttaat tcctgaaatc       120
     cttggagatg aagcgcctca cattatgtac tgggctggga aagacttagc gcgtaaattc       180
     ccacttgaat ccatggaaga gataagagaa ttctttgaag aagcctcttt tgggacactt       240
     agtattttaa aggaaaagaa agatgagttg cgtttacttt tagaaggtga catggttgtt       300
     tcgcggttcc gtacacaaga aaatccaact tttaaattgg aagctggttt tatcgcagag       360
     caattacaaa cacagaagaa gctctataca gaaagttacg atgaaataga taaacgtaaa       420
     aaacaagtga cgattatcgt taaatgggat cgtaaagaaa cgattgataa cgaagaacgt       480
     tactaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page